BLASTX nr result
ID: Chrysanthemum22_contig00031614
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00031614 (487 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021824363.1| LOW QUALITY PROTEIN: pullulanase 1, chloropl... 65 3e-09 ref|XP_022006098.1| pullulanase 1, chloroplastic isoform X2 [Hel... 65 4e-09 ref|XP_022006097.1| pullulanase 1, chloroplastic isoform X1 [Hel... 65 4e-09 ref|XP_023879675.1| pullulanase 1, chloroplastic isoform X3 [Que... 64 6e-09 ref|XP_023879674.1| pullulanase 1, chloroplastic isoform X2 [Que... 64 7e-09 ref|XP_023879673.1| pullulanase 1, chloroplastic isoform X1 [Que... 64 7e-09 ref|XP_008233250.1| PREDICTED: pullulanase 1, chloroplastic [Pru... 64 9e-09 gb|ONI23749.1| hypothetical protein PRUPE_2G205800 [Prunus persica] 63 2e-08 gb|ONI23746.1| hypothetical protein PRUPE_2G205800 [Prunus persica] 63 2e-08 gb|ONI23745.1| hypothetical protein PRUPE_2G205800 [Prunus persica] 63 2e-08 ref|XP_007220271.1| pullulanase 1, chloroplastic [Prunus persica... 63 2e-08 gb|ONI23748.1| hypothetical protein PRUPE_2G205800 [Prunus persica] 63 2e-08 ref|XP_010918920.1| PREDICTED: pullulanase 1, chloroplastic isof... 63 2e-08 ref|XP_010918919.1| PREDICTED: pullulanase 1, chloroplastic isof... 63 2e-08 ref|XP_023751382.1| pullulanase 1, chloroplastic [Lactuca sativa... 62 4e-08 gb|ESR49767.1| hypothetical protein CICLE_v10031035mg [Citrus cl... 61 1e-07 gb|KDO47565.1| hypothetical protein CISIN_1g0020792mg, partial [... 61 1e-07 ref|XP_015387859.1| PREDICTED: pullulanase 1, chloroplastic isof... 61 1e-07 ref|XP_015387858.1| PREDICTED: pullulanase 1, chloroplastic isof... 61 1e-07 ref|XP_012834783.1| PREDICTED: LOW QUALITY PROTEIN: pullulanase ... 61 1e-07 >ref|XP_021824363.1| LOW QUALITY PROTEIN: pullulanase 1, chloroplastic [Prunus avium] Length = 855 Score = 65.5 bits (158), Expect = 3e-09 Identities = 31/42 (73%), Positives = 34/42 (80%) Frame = +1 Query: 178 TYLVNLDSENVKPHKWDNLVHEKLDIVDFVDISIDELHIRDF 303 T LVNLDS+N+KP WDNLV EK DI+ F DISI ELHIRDF Sbjct: 302 TLLVNLDSDNIKPEGWDNLVDEKPDILSFSDISIYELHIRDF 343 >ref|XP_022006098.1| pullulanase 1, chloroplastic isoform X2 [Helianthus annuus] Length = 951 Score = 65.1 bits (157), Expect = 4e-09 Identities = 29/42 (69%), Positives = 36/42 (85%) Frame = +1 Query: 178 TYLVNLDSENVKPHKWDNLVHEKLDIVDFVDISIDELHIRDF 303 T+LVNLDS+++KPHKWD+L EK +I DF DISI ELH+RDF Sbjct: 289 TFLVNLDSDDLKPHKWDDLGDEKPNIADFSDISIYELHVRDF 330 >ref|XP_022006097.1| pullulanase 1, chloroplastic isoform X1 [Helianthus annuus] gb|OTF99361.1| putative limit dextrinase [Helianthus annuus] Length = 952 Score = 65.1 bits (157), Expect = 4e-09 Identities = 29/42 (69%), Positives = 36/42 (85%) Frame = +1 Query: 178 TYLVNLDSENVKPHKWDNLVHEKLDIVDFVDISIDELHIRDF 303 T+LVNLDS+++KPHKWD+L EK +I DF DISI ELH+RDF Sbjct: 289 TFLVNLDSDDLKPHKWDDLGDEKPNIADFSDISIYELHVRDF 330 >ref|XP_023879675.1| pullulanase 1, chloroplastic isoform X3 [Quercus suber] Length = 825 Score = 64.3 bits (155), Expect = 6e-09 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = +1 Query: 178 TYLVNLDSENVKPHKWDNLVHEKLDIVDFVDISIDELHIRDF 303 T+LVNLDS+ +KP +WDNL +EK DI+ F DISI ELHIRDF Sbjct: 302 TFLVNLDSDTLKPEEWDNLANEKPDILSFSDISIYELHIRDF 343 >ref|XP_023879674.1| pullulanase 1, chloroplastic isoform X2 [Quercus suber] gb|POE76574.1| pullulanase 1, chloroplastic [Quercus suber] Length = 961 Score = 64.3 bits (155), Expect = 7e-09 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = +1 Query: 178 TYLVNLDSENVKPHKWDNLVHEKLDIVDFVDISIDELHIRDF 303 T+LVNLDS+ +KP +WDNL +EK DI+ F DISI ELHIRDF Sbjct: 300 TFLVNLDSDTLKPEEWDNLANEKPDILSFSDISIYELHIRDF 341 >ref|XP_023879673.1| pullulanase 1, chloroplastic isoform X1 [Quercus suber] gb|POE76573.1| pullulanase 1, chloroplastic [Quercus suber] Length = 963 Score = 64.3 bits (155), Expect = 7e-09 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = +1 Query: 178 TYLVNLDSENVKPHKWDNLVHEKLDIVDFVDISIDELHIRDF 303 T+LVNLDS+ +KP +WDNL +EK DI+ F DISI ELHIRDF Sbjct: 302 TFLVNLDSDTLKPEEWDNLANEKPDILSFSDISIYELHIRDF 343 >ref|XP_008233250.1| PREDICTED: pullulanase 1, chloroplastic [Prunus mume] Length = 967 Score = 63.9 bits (154), Expect = 9e-09 Identities = 34/55 (61%), Positives = 38/55 (69%) Frame = +1 Query: 139 D*HALGRK*FSPITYLVNLDSENVKPHKWDNLVHEKLDIVDFVDISIDELHIRDF 303 D +A G S T LVNLDS+N+KP WD LV EK DI+ F DISI ELHIRDF Sbjct: 289 DPYARGLSSDSRRTLLVNLDSDNIKPEGWDKLVDEKPDILSFSDISIYELHIRDF 343 >gb|ONI23749.1| hypothetical protein PRUPE_2G205800 [Prunus persica] Length = 697 Score = 63.2 bits (152), Expect = 2e-08 Identities = 30/42 (71%), Positives = 33/42 (78%) Frame = +1 Query: 178 TYLVNLDSENVKPHKWDNLVHEKLDIVDFVDISIDELHIRDF 303 T LVNLDS+N+KP WD LV EK DI+ F DISI ELHIRDF Sbjct: 302 TLLVNLDSDNIKPEGWDKLVDEKPDILSFSDISIYELHIRDF 343 >gb|ONI23746.1| hypothetical protein PRUPE_2G205800 [Prunus persica] Length = 777 Score = 63.2 bits (152), Expect = 2e-08 Identities = 30/42 (71%), Positives = 33/42 (78%) Frame = +1 Query: 178 TYLVNLDSENVKPHKWDNLVHEKLDIVDFVDISIDELHIRDF 303 T LVNLDS+N+KP WD LV EK DI+ F DISI ELHIRDF Sbjct: 302 TLLVNLDSDNIKPEGWDKLVDEKPDILSFSDISIYELHIRDF 343 >gb|ONI23745.1| hypothetical protein PRUPE_2G205800 [Prunus persica] Length = 939 Score = 63.2 bits (152), Expect = 2e-08 Identities = 30/42 (71%), Positives = 33/42 (78%) Frame = +1 Query: 178 TYLVNLDSENVKPHKWDNLVHEKLDIVDFVDISIDELHIRDF 303 T LVNLDS+N+KP WD LV EK DI+ F DISI ELHIRDF Sbjct: 302 TLLVNLDSDNIKPEGWDKLVDEKPDILSFSDISIYELHIRDF 343 >ref|XP_007220271.1| pullulanase 1, chloroplastic [Prunus persica] gb|ONI23747.1| hypothetical protein PRUPE_2G205800 [Prunus persica] Length = 965 Score = 63.2 bits (152), Expect = 2e-08 Identities = 30/42 (71%), Positives = 33/42 (78%) Frame = +1 Query: 178 TYLVNLDSENVKPHKWDNLVHEKLDIVDFVDISIDELHIRDF 303 T LVNLDS+N+KP WD LV EK DI+ F DISI ELHIRDF Sbjct: 302 TLLVNLDSDNIKPEGWDKLVDEKPDILSFSDISIYELHIRDF 343 >gb|ONI23748.1| hypothetical protein PRUPE_2G205800 [Prunus persica] Length = 966 Score = 63.2 bits (152), Expect = 2e-08 Identities = 30/42 (71%), Positives = 33/42 (78%) Frame = +1 Query: 178 TYLVNLDSENVKPHKWDNLVHEKLDIVDFVDISIDELHIRDF 303 T LVNLDS+N+KP WD LV EK DI+ F DISI ELHIRDF Sbjct: 303 TLLVNLDSDNIKPEGWDKLVDEKPDILSFSDISIYELHIRDF 344 >ref|XP_010918920.1| PREDICTED: pullulanase 1, chloroplastic isoform X2 [Elaeis guineensis] Length = 946 Score = 62.8 bits (151), Expect = 2e-08 Identities = 31/57 (54%), Positives = 38/57 (66%) Frame = +1 Query: 133 IAD*HALGRK*FSPITYLVNLDSENVKPHKWDNLVHEKLDIVDFVDISIDELHIRDF 303 + D +A G T+L+NLDSEN+KP WD L EK D++ F DISI ELHIRDF Sbjct: 287 VTDPYARGLSSNGKRTWLINLDSENLKPEGWDKLADEKPDLLSFSDISIYELHIRDF 343 >ref|XP_010918919.1| PREDICTED: pullulanase 1, chloroplastic isoform X1 [Elaeis guineensis] Length = 965 Score = 62.8 bits (151), Expect = 2e-08 Identities = 31/57 (54%), Positives = 38/57 (66%) Frame = +1 Query: 133 IAD*HALGRK*FSPITYLVNLDSENVKPHKWDNLVHEKLDIVDFVDISIDELHIRDF 303 + D +A G T+L+NLDSEN+KP WD L EK D++ F DISI ELHIRDF Sbjct: 287 VTDPYARGLSSNGKRTWLINLDSENLKPEGWDKLADEKPDLLSFSDISIYELHIRDF 343 >ref|XP_023751382.1| pullulanase 1, chloroplastic [Lactuca sativa] gb|PLY94815.1| hypothetical protein LSAT_2X103740 [Lactuca sativa] Length = 963 Score = 62.0 bits (149), Expect = 4e-08 Identities = 28/42 (66%), Positives = 35/42 (83%) Frame = +1 Query: 178 TYLVNLDSENVKPHKWDNLVHEKLDIVDFVDISIDELHIRDF 303 T+LVNLDS+ +KP KWD+L +K +IVDF DISI ELH+RDF Sbjct: 298 TFLVNLDSDALKPQKWDDLADKKPNIVDFSDISIYELHVRDF 339 >gb|ESR49767.1| hypothetical protein CICLE_v10031035mg [Citrus clementina] Length = 590 Score = 60.8 bits (146), Expect = 1e-07 Identities = 28/42 (66%), Positives = 33/42 (78%) Frame = +1 Query: 178 TYLVNLDSENVKPHKWDNLVHEKLDIVDFVDISIDELHIRDF 303 T LVNLDS+ +KP WD LV+EK DI+ F DISI ELH+RDF Sbjct: 306 TLLVNLDSDTLKPEGWDKLVYEKPDILSFSDISIYELHVRDF 347 >gb|KDO47565.1| hypothetical protein CISIN_1g0020792mg, partial [Citrus sinensis] gb|KDO47566.1| hypothetical protein CISIN_1g0020792mg, partial [Citrus sinensis] gb|KDO47567.1| hypothetical protein CISIN_1g0020792mg, partial [Citrus sinensis] Length = 678 Score = 60.8 bits (146), Expect = 1e-07 Identities = 28/42 (66%), Positives = 33/42 (78%) Frame = +1 Query: 178 TYLVNLDSENVKPHKWDNLVHEKLDIVDFVDISIDELHIRDF 303 T LVNLDS+ +KP WD LV+EK DI+ F DISI ELH+RDF Sbjct: 304 TLLVNLDSDTLKPEGWDKLVYEKPDILSFSDISIYELHVRDF 345 >ref|XP_015387859.1| PREDICTED: pullulanase 1, chloroplastic isoform X4 [Citrus sinensis] ref|XP_024042245.1| pullulanase 1, chloroplastic isoform X4 [Citrus clementina] Length = 817 Score = 60.8 bits (146), Expect = 1e-07 Identities = 28/42 (66%), Positives = 33/42 (78%) Frame = +1 Query: 178 TYLVNLDSENVKPHKWDNLVHEKLDIVDFVDISIDELHIRDF 303 T LVNLDS+ +KP WD LV+EK DI+ F DISI ELH+RDF Sbjct: 306 TLLVNLDSDTLKPEGWDKLVYEKPDILSFSDISIYELHVRDF 347 >ref|XP_015387858.1| PREDICTED: pullulanase 1, chloroplastic isoform X3 [Citrus sinensis] Length = 863 Score = 60.8 bits (146), Expect = 1e-07 Identities = 28/42 (66%), Positives = 33/42 (78%) Frame = +1 Query: 178 TYLVNLDSENVKPHKWDNLVHEKLDIVDFVDISIDELHIRDF 303 T LVNLDS+ +KP WD LV+EK DI+ F DISI ELH+RDF Sbjct: 306 TLLVNLDSDTLKPEGWDKLVYEKPDILSFSDISIYELHVRDF 347 >ref|XP_012834783.1| PREDICTED: LOW QUALITY PROTEIN: pullulanase 1, chloroplastic [Erythranthe guttata] Length = 895 Score = 60.8 bits (146), Expect = 1e-07 Identities = 28/42 (66%), Positives = 32/42 (76%) Frame = +1 Query: 178 TYLVNLDSENVKPHKWDNLVHEKLDIVDFVDISIDELHIRDF 303 T LVN+DSE +KP WD LV EK D+V F DISI ELH+RDF Sbjct: 232 TLLVNIDSEALKPESWDRLVDEKRDLVSFSDISIYELHVRDF 273