BLASTX nr result
ID: Chrysanthemum22_contig00031530
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00031530 (396 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021989727.1| armadillo repeat-containing protein 7 [Helia... 70 4e-12 gb|OTG12464.1| putative armadillo-type fold, Ubiquitin-related d... 70 2e-11 ref|XP_012075575.1| armadillo repeat-containing protein 7 isofor... 65 9e-11 ref|XP_012075572.1| armadillo repeat-containing protein 7 isofor... 65 2e-10 emb|CDP01689.1| unnamed protein product [Coffea canephora] 64 5e-10 ref|XP_009357804.1| PREDICTED: armadillo repeat-containing prote... 64 5e-10 ref|XP_010648899.1| PREDICTED: armadillo repeat-containing prote... 63 1e-09 ref|XP_002270403.1| PREDICTED: armadillo repeat-containing prote... 63 1e-09 ref|XP_019182748.1| PREDICTED: armadillo repeat-containing prote... 63 2e-09 gb|KVH88220.1| Armadillo [Cynara cardunculus var. scolymus] 62 2e-09 gb|OVA02589.1| Armadillo [Macleaya cordata] 62 4e-09 ref|XP_008348587.1| PREDICTED: armadillo repeat-containing prote... 62 5e-09 ref|XP_023732782.1| armadillo repeat-containing protein 7 [Lactu... 61 6e-09 dbj|GAY64700.1| hypothetical protein CUMW_235490 [Citrus unshiu] 61 6e-09 ref|XP_015577303.1| PREDICTED: armadillo repeat-containing prote... 61 6e-09 ref|XP_006441514.1| armadillo repeat-containing protein 7 isofor... 61 6e-09 ref|XP_022879726.1| armadillo repeat-containing protein 7-like i... 61 9e-09 ref|XP_022879722.1| armadillo repeat-containing protein 7-like i... 61 9e-09 gb|PNX89220.1| armadillo repeat-containing protein [Trifolium pr... 59 1e-08 ref|XP_003616184.1| armadillo/beta-catenin-like repeat protein [... 60 1e-08 >ref|XP_021989727.1| armadillo repeat-containing protein 7 [Helianthus annuus] ref|XP_021989728.1| armadillo repeat-containing protein 7 [Helianthus annuus] Length = 178 Score = 69.7 bits (169), Expect = 4e-12 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = -3 Query: 394 RPEVVDIIRRYAAAGAVSVSFSNLAQAFLDKHVSQNH 284 RPEVVDII+RYAAAG+VSVSFSNLAQAFLDKHV +NH Sbjct: 142 RPEVVDIIKRYAAAGSVSVSFSNLAQAFLDKHVPENH 178 >gb|OTG12464.1| putative armadillo-type fold, Ubiquitin-related domain protein [Helianthus annuus] Length = 303 Score = 69.7 bits (169), Expect = 2e-11 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = -3 Query: 394 RPEVVDIIRRYAAAGAVSVSFSNLAQAFLDKHVSQNH 284 RPEVVDII+RYAAAG+VSVSFSNLAQAFLDKHV +NH Sbjct: 267 RPEVVDIIKRYAAAGSVSVSFSNLAQAFLDKHVPENH 303 >ref|XP_012075575.1| armadillo repeat-containing protein 7 isoform X2 [Jatropha curcas] gb|KDP34905.1| hypothetical protein JCGZ_09193 [Jatropha curcas] Length = 150 Score = 65.5 bits (158), Expect = 9e-11 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = -3 Query: 394 RPEVVDIIRRYAAAGAVSVSFSNLAQAFLDKHVSQN 287 +PEV+DII+RYAAAGAVSVSFSNLA+AFLDKHVS N Sbjct: 109 KPEVIDIIQRYAAAGAVSVSFSNLAKAFLDKHVSDN 144 >ref|XP_012075572.1| armadillo repeat-containing protein 7 isoform X1 [Jatropha curcas] ref|XP_012075573.1| armadillo repeat-containing protein 7 isoform X1 [Jatropha curcas] ref|XP_020536090.1| armadillo repeat-containing protein 7 isoform X1 [Jatropha curcas] ref|XP_020536091.1| armadillo repeat-containing protein 7 isoform X1 [Jatropha curcas] Length = 183 Score = 65.5 bits (158), Expect = 2e-10 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = -3 Query: 394 RPEVVDIIRRYAAAGAVSVSFSNLAQAFLDKHVSQN 287 +PEV+DII+RYAAAGAVSVSFSNLA+AFLDKHVS N Sbjct: 142 KPEVIDIIQRYAAAGAVSVSFSNLAKAFLDKHVSDN 177 >emb|CDP01689.1| unnamed protein product [Coffea canephora] Length = 182 Score = 64.3 bits (155), Expect = 5e-10 Identities = 30/35 (85%), Positives = 35/35 (100%) Frame = -3 Query: 394 RPEVVDIIRRYAAAGAVSVSFSNLAQAFLDKHVSQ 290 +PEVVDII+RYA+AGAVSVSFSN+AQAFLDKHVS+ Sbjct: 142 KPEVVDIIKRYASAGAVSVSFSNIAQAFLDKHVSE 176 >ref|XP_009357804.1| PREDICTED: armadillo repeat-containing protein 7 isoform X1 [Pyrus x bretschneideri] ref|XP_009357805.1| PREDICTED: armadillo repeat-containing protein 7 isoform X1 [Pyrus x bretschneideri] ref|XP_018503296.1| PREDICTED: armadillo repeat-containing protein 7 isoform X1 [Pyrus x bretschneideri] ref|XP_018503297.1| PREDICTED: armadillo repeat-containing protein 7 isoform X1 [Pyrus x bretschneideri] ref|XP_018503299.1| PREDICTED: armadillo repeat-containing protein 7 isoform X1 [Pyrus x bretschneideri] Length = 183 Score = 64.3 bits (155), Expect = 5e-10 Identities = 29/36 (80%), Positives = 36/36 (100%) Frame = -3 Query: 394 RPEVVDIIRRYAAAGAVSVSFSNLAQAFLDKHVSQN 287 +PEVVD+++RYAAAGAV+VSFSNLA+AFLDKHVS+N Sbjct: 143 KPEVVDVMKRYAAAGAVNVSFSNLAKAFLDKHVSEN 178 >ref|XP_010648899.1| PREDICTED: armadillo repeat-containing protein 7 isoform X2 [Vitis vinifera] Length = 175 Score = 63.2 bits (152), Expect = 1e-09 Identities = 29/35 (82%), Positives = 35/35 (100%) Frame = -3 Query: 394 RPEVVDIIRRYAAAGAVSVSFSNLAQAFLDKHVSQ 290 RPEVVD+I++YAAAG+VSV+FSNLA+AFLDKHVSQ Sbjct: 140 RPEVVDVIKKYAAAGSVSVNFSNLAKAFLDKHVSQ 174 >ref|XP_002270403.1| PREDICTED: armadillo repeat-containing protein 7 isoform X1 [Vitis vinifera] ref|XP_010648898.1| PREDICTED: armadillo repeat-containing protein 7 isoform X1 [Vitis vinifera] emb|CBI27351.3| unnamed protein product, partial [Vitis vinifera] Length = 177 Score = 63.2 bits (152), Expect = 1e-09 Identities = 29/35 (82%), Positives = 35/35 (100%) Frame = -3 Query: 394 RPEVVDIIRRYAAAGAVSVSFSNLAQAFLDKHVSQ 290 RPEVVD+I++YAAAG+VSV+FSNLA+AFLDKHVSQ Sbjct: 142 RPEVVDVIKKYAAAGSVSVNFSNLAKAFLDKHVSQ 176 >ref|XP_019182748.1| PREDICTED: armadillo repeat-containing protein 7 [Ipomoea nil] ref|XP_019182749.1| PREDICTED: armadillo repeat-containing protein 7 [Ipomoea nil] Length = 179 Score = 62.8 bits (151), Expect = 2e-09 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = -3 Query: 394 RPEVVDIIRRYAAAGAVSVSFSNLAQAFLDKHVS 293 +PEVVD+I+RYAAAG VSVSFSNLAQAFLDKH+S Sbjct: 143 KPEVVDVIKRYAAAGEVSVSFSNLAQAFLDKHIS 176 >gb|KVH88220.1| Armadillo [Cynara cardunculus var. scolymus] Length = 178 Score = 62.4 bits (150), Expect = 2e-09 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = -3 Query: 394 RPEVVDIIRRYAAAGAVSVSFSNLAQAFLDKHVSQN 287 RPEVV+IIRRYAAAG VS+SFSNLA++FLDKHV +N Sbjct: 142 RPEVVNIIRRYAAAGGVSISFSNLARSFLDKHVPEN 177 >gb|OVA02589.1| Armadillo [Macleaya cordata] Length = 178 Score = 61.6 bits (148), Expect = 4e-09 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = -3 Query: 394 RPEVVDIIRRYAAAGAVSVSFSNLAQAFLDKHVS 293 RPEV+++I RYAAAGAVSVSFSNLA+AFLDKH+S Sbjct: 142 RPEVIEVIERYAAAGAVSVSFSNLAKAFLDKHIS 175 >ref|XP_008348587.1| PREDICTED: armadillo repeat-containing protein 7-like [Malus domestica] ref|XP_017181368.1| PREDICTED: armadillo repeat-containing protein 7-like [Malus domestica] Length = 183 Score = 61.6 bits (148), Expect = 5e-09 Identities = 28/37 (75%), Positives = 36/37 (97%) Frame = -3 Query: 394 RPEVVDIIRRYAAAGAVSVSFSNLAQAFLDKHVSQNH 284 +PEVVD+++RYAAA AV+VSFSNLA+AFLDKHVS+N+ Sbjct: 143 KPEVVDVMKRYAAAEAVNVSFSNLAKAFLDKHVSENN 179 >ref|XP_023732782.1| armadillo repeat-containing protein 7 [Lactuca sativa] ref|XP_023732783.1| armadillo repeat-containing protein 7 [Lactuca sativa] gb|PLY74673.1| hypothetical protein LSAT_5X79100 [Lactuca sativa] Length = 178 Score = 61.2 bits (147), Expect = 6e-09 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = -3 Query: 394 RPEVVDIIRRYAAAGAVSVSFSNLAQAFLDKHVSQNH 284 RPEVVD+I+RYAAA V VSF+NLAQAFLDKHV + H Sbjct: 142 RPEVVDVIKRYAAADGVGVSFTNLAQAFLDKHVPEKH 178 >dbj|GAY64700.1| hypothetical protein CUMW_235490 [Citrus unshiu] Length = 178 Score = 61.2 bits (147), Expect = 6e-09 Identities = 28/36 (77%), Positives = 35/36 (97%) Frame = -3 Query: 394 RPEVVDIIRRYAAAGAVSVSFSNLAQAFLDKHVSQN 287 +PEVVD+IRRYAAA +V+VSFSNLA+AFLDKHV++N Sbjct: 142 KPEVVDVIRRYAAAESVNVSFSNLAKAFLDKHVTEN 177 >ref|XP_015577303.1| PREDICTED: armadillo repeat-containing protein 7 isoform X1 [Ricinus communis] ref|XP_015577304.1| PREDICTED: armadillo repeat-containing protein 7 isoform X1 [Ricinus communis] ref|XP_015577305.1| PREDICTED: armadillo repeat-containing protein 7 isoform X1 [Ricinus communis] ref|XP_015577306.1| PREDICTED: armadillo repeat-containing protein 7 isoform X1 [Ricinus communis] ref|XP_015577307.1| PREDICTED: armadillo repeat-containing protein 7 isoform X1 [Ricinus communis] ref|XP_015577308.1| PREDICTED: armadillo repeat-containing protein 7 isoform X1 [Ricinus communis] ref|XP_015577309.1| PREDICTED: armadillo repeat-containing protein 7 isoform X1 [Ricinus communis] ref|XP_015577310.1| PREDICTED: armadillo repeat-containing protein 7 isoform X1 [Ricinus communis] ref|XP_015577312.1| PREDICTED: armadillo repeat-containing protein 7 isoform X1 [Ricinus communis] ref|XP_015577313.1| PREDICTED: armadillo repeat-containing protein 7 isoform X1 [Ricinus communis] ref|XP_015577314.1| PREDICTED: armadillo repeat-containing protein 7 isoform X1 [Ricinus communis] ref|XP_015577315.1| PREDICTED: armadillo repeat-containing protein 7 isoform X1 [Ricinus communis] ref|XP_015577316.1| PREDICTED: armadillo repeat-containing protein 7 isoform X1 [Ricinus communis] ref|XP_015577317.1| PREDICTED: armadillo repeat-containing protein 7 isoform X1 [Ricinus communis] Length = 178 Score = 61.2 bits (147), Expect = 6e-09 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = -3 Query: 394 RPEVVDIIRRYAAAGAVSVSFSNLAQAFLDKHVSQNH 284 RPEV+D+I+RYAAA AV+VSFSNLA AFLDKHVS N+ Sbjct: 142 RPEVIDVIQRYAAAEAVNVSFSNLANAFLDKHVSGNN 178 >ref|XP_006441514.1| armadillo repeat-containing protein 7 isoform X1 [Citrus clementina] gb|ESR54754.1| hypothetical protein CICLE_v10022503mg [Citrus clementina] gb|KDO56042.1| hypothetical protein CISIN_1g030369mg [Citrus sinensis] Length = 178 Score = 61.2 bits (147), Expect = 6e-09 Identities = 28/36 (77%), Positives = 35/36 (97%) Frame = -3 Query: 394 RPEVVDIIRRYAAAGAVSVSFSNLAQAFLDKHVSQN 287 +PEVVD+IRRYAAA +V+VSFSNLA+AFLDKHV++N Sbjct: 142 KPEVVDVIRRYAAAESVNVSFSNLAKAFLDKHVTEN 177 >ref|XP_022879726.1| armadillo repeat-containing protein 7-like isoform X4 [Olea europaea var. sylvestris] Length = 178 Score = 60.8 bits (146), Expect = 9e-09 Identities = 27/35 (77%), Positives = 33/35 (94%) Frame = -3 Query: 394 RPEVVDIIRRYAAAGAVSVSFSNLAQAFLDKHVSQ 290 +PEVVD+I+RYAA+GA+S SFSNLA AFLDKHVS+ Sbjct: 142 KPEVVDVIKRYAASGAISASFSNLAHAFLDKHVSE 176 >ref|XP_022879722.1| armadillo repeat-containing protein 7-like isoform X3 [Olea europaea var. sylvestris] ref|XP_022879724.1| armadillo repeat-containing protein 7-like isoform X3 [Olea europaea var. sylvestris] ref|XP_022879725.1| armadillo repeat-containing protein 7-like isoform X3 [Olea europaea var. sylvestris] Length = 179 Score = 60.8 bits (146), Expect = 9e-09 Identities = 27/35 (77%), Positives = 33/35 (94%) Frame = -3 Query: 394 RPEVVDIIRRYAAAGAVSVSFSNLAQAFLDKHVSQ 290 +PEVVD+I+RYAA+GA+S SFSNLA AFLDKHVS+ Sbjct: 143 KPEVVDVIKRYAASGAISASFSNLAHAFLDKHVSE 177 >gb|PNX89220.1| armadillo repeat-containing protein [Trifolium pratense] Length = 94 Score = 58.5 bits (140), Expect = 1e-08 Identities = 27/36 (75%), Positives = 33/36 (91%) Frame = -3 Query: 394 RPEVVDIIRRYAAAGAVSVSFSNLAQAFLDKHVSQN 287 +PEV+D+I+RYAAA VSVSFSNLA+AFLDKH+S N Sbjct: 59 KPEVIDVIKRYAAAEEVSVSFSNLAKAFLDKHLSGN 94 >ref|XP_003616184.1| armadillo/beta-catenin-like repeat protein [Medicago truncatula] gb|AES99142.1| armadillo/beta-catenin-like repeat protein [Medicago truncatula] gb|AFK40260.1| unknown [Medicago truncatula] Length = 178 Score = 60.5 bits (145), Expect = 1e-08 Identities = 27/37 (72%), Positives = 35/37 (94%) Frame = -3 Query: 394 RPEVVDIIRRYAAAGAVSVSFSNLAQAFLDKHVSQNH 284 +PEV+D+I+RYAAA VSVSFSNLA+AFLDKH+S+N+ Sbjct: 142 KPEVIDVIKRYAAAEEVSVSFSNLAKAFLDKHLSRNY 178