BLASTX nr result
ID: Chrysanthemum22_contig00031254
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00031254 (474 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023751729.1| protein PAF1 homolog [Lactuca sativa] >gi|13... 70 4e-11 gb|KVH97977.1| RNA polymerase II-associated, Paf1, partial [Cyna... 68 3e-10 ref|XP_022009861.1| protein PAF1 homolog [Helianthus annuus] >gi... 65 2e-09 >ref|XP_023751729.1| protein PAF1 homolog [Lactuca sativa] ref|XP_023751730.1| protein PAF1 homolog [Lactuca sativa] Length = 683 Score = 70.5 bits (171), Expect = 4e-11 Identities = 34/56 (60%), Positives = 43/56 (76%), Gaps = 6/56 (10%) Frame = +2 Query: 233 KAKENRHDGYRRSSNEIDNSKRRD-----HAGPSRHHSKPS-LPPMPGRKSNGPLG 382 +AK++RHD +++ S E++NSK RD HAGPSR HSKPS LPP+P RKSNGP G Sbjct: 164 QAKQSRHDSFKKPSTELENSKWRDSSHSHHAGPSRQHSKPSTLPPLPARKSNGPPG 219 >gb|KVH97977.1| RNA polymerase II-associated, Paf1, partial [Cynara cardunculus var. scolymus] Length = 664 Score = 67.8 bits (164), Expect = 3e-10 Identities = 34/54 (62%), Positives = 42/54 (77%), Gaps = 6/54 (11%) Frame = +2 Query: 230 EKAKENRHDGYRRSSNEIDNSKRRD-----HAGPSRHHSKP-SLPPMPGRKSNG 373 ++AKENRH+GY+R SN+ + SK R+ HAGPSR HSKP SLPP+P RKSNG Sbjct: 168 DQAKENRHEGYKRPSNDPEASKWRNPSHSHHAGPSRQHSKPSSLPPVPARKSNG 221 >ref|XP_022009861.1| protein PAF1 homolog [Helianthus annuus] gb|OTG33215.1| putative RNA polymerase II associated factor Paf1 [Helianthus annuus] Length = 680 Score = 65.5 bits (158), Expect = 2e-09 Identities = 32/57 (56%), Positives = 42/57 (73%), Gaps = 1/57 (1%) Frame = +2 Query: 215 SKAKAEKAKENRHDGYRRSSNEIDNSKRRDHAGPSRHHSKPS-LPPMPGRKSNGPLG 382 S + + KE R DG++R SN+++++K HAGPSR HSKPS LPP+P RKSNGP G Sbjct: 142 SAPASNQTKEIRQDGHKRPSNDVESNKGH-HAGPSRQHSKPSNLPPVPARKSNGPSG 197