BLASTX nr result
ID: Chrysanthemum22_contig00030863
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00030863 (862 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVH94928.1| Zinc finger, RING/FYVE/PHD-type [Cynara carduncul... 74 3e-11 ref|XP_023728403.1| uncharacterized protein LOC111876109 [Lactuc... 65 5e-08 gb|KVI03242.1| Zinc finger, RING/FYVE/PHD-type [Cynara carduncul... 59 3e-06 ref|XP_012832317.1| PREDICTED: uncharacterized protein LOC105953... 59 4e-06 ref|XP_021987792.1| E3 ubiquitin ligase BIG BROTHER-related-like... 58 7e-06 >gb|KVH94928.1| Zinc finger, RING/FYVE/PHD-type [Cynara cardunculus var. scolymus] Length = 463 Score = 74.3 bits (181), Expect = 3e-11 Identities = 30/46 (65%), Positives = 38/46 (82%) Frame = +1 Query: 724 MENTSPIAPFDQPALCALCHRTLTSDNDPIDLESITICGDCKFLFL 861 M+ + PFD P +CA+CHRTL+S+NDPIDL++I ICGDCKFLFL Sbjct: 1 MDGRLSVEPFDPPGMCAVCHRTLSSENDPIDLQAIGICGDCKFLFL 46 >ref|XP_023728403.1| uncharacterized protein LOC111876109 [Lactuca sativa] gb|PLY78029.1| hypothetical protein LSAT_9X39880 [Lactuca sativa] Length = 442 Score = 64.7 bits (156), Expect = 5e-08 Identities = 27/47 (57%), Positives = 33/47 (70%) Frame = +1 Query: 721 DMENTSPIAPFDQPALCALCHRTLTSDNDPIDLESITICGDCKFLFL 861 D S + P + P +C LCHR L +ND IDL+SI+ICGDCKFLFL Sbjct: 2 DGSGRSAVQPLEPPGICGLCHRILPLENDAIDLDSISICGDCKFLFL 48 >gb|KVI03242.1| Zinc finger, RING/FYVE/PHD-type [Cynara cardunculus var. scolymus] Length = 353 Score = 58.9 bits (141), Expect = 3e-06 Identities = 26/47 (55%), Positives = 34/47 (72%) Frame = +1 Query: 721 DMENTSPIAPFDQPALCALCHRTLTSDNDPIDLESITICGDCKFLFL 861 DM T + P+DQP C LCHR L+S+ I++E+ +ICGDCKFLFL Sbjct: 2 DMNGTITVEPWDQPRRCVLCHRILSSE---IEVEATSICGDCKFLFL 45 >ref|XP_012832317.1| PREDICTED: uncharacterized protein LOC105953219 [Erythranthe guttata] gb|EYU42060.1| hypothetical protein MIMGU_mgv1a024323mg [Erythranthe guttata] Length = 506 Score = 58.9 bits (141), Expect = 4e-06 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = +1 Query: 763 ALCALCHRTLTSDNDPIDLESITICGDCKFLFL 861 A CALCHR L+SDN+ +DLE+I+ICGDCKFL L Sbjct: 39 ATCALCHRALSSDNETVDLETISICGDCKFLLL 71 >ref|XP_021987792.1| E3 ubiquitin ligase BIG BROTHER-related-like [Helianthus annuus] Length = 434 Score = 58.2 bits (139), Expect = 7e-06 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = +1 Query: 754 DQPALCALCHRTLTSDNDPIDLESITICGDCKFLFL 861 D +CALC RTL+S+ D IDL+SITICGDCKFL L Sbjct: 3 DASQICALCRRTLSSETDSIDLDSITICGDCKFLLL 38