BLASTX nr result
ID: Chrysanthemum22_contig00030845
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00030845 (863 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023773234.1| VAN3-binding protein [Lactuca sativa] 44 2e-06 gb|PLY78223.1| hypothetical protein LSAT_8X57160 [Lactuca sativa] 44 2e-06 >ref|XP_023773234.1| VAN3-binding protein [Lactuca sativa] Length = 453 Score = 44.3 bits (103), Expect(2) = 2e-06 Identities = 20/33 (60%), Positives = 24/33 (72%) Frame = +1 Query: 763 RGVKSTKKNGMRYGYHKDFLNEENFLGICNQEL 861 RGVK +K +G Y ++ L EENFLGICNQEL Sbjct: 301 RGVKESKSHGKSSAYCEELLPEENFLGICNQEL 333 Score = 37.0 bits (84), Expect(2) = 2e-06 Identities = 19/27 (70%), Positives = 21/27 (77%) Frame = +3 Query: 684 ALREPATLQATTLKEVGNIAVVIPVDK 764 ALR ATL+A LKEV NIA VIPVD+ Sbjct: 275 ALRGAATLKARALKEVWNIAAVIPVDR 301 >gb|PLY78223.1| hypothetical protein LSAT_8X57160 [Lactuca sativa] Length = 440 Score = 44.3 bits (103), Expect(2) = 2e-06 Identities = 20/33 (60%), Positives = 24/33 (72%) Frame = +1 Query: 763 RGVKSTKKNGMRYGYHKDFLNEENFLGICNQEL 861 RGVK +K +G Y ++ L EENFLGICNQEL Sbjct: 288 RGVKESKSHGKSSAYCEELLPEENFLGICNQEL 320 Score = 37.0 bits (84), Expect(2) = 2e-06 Identities = 19/27 (70%), Positives = 21/27 (77%) Frame = +3 Query: 684 ALREPATLQATTLKEVGNIAVVIPVDK 764 ALR ATL+A LKEV NIA VIPVD+ Sbjct: 262 ALRGAATLKARALKEVWNIAAVIPVDR 288