BLASTX nr result
ID: Chrysanthemum22_contig00030474
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00030474 (957 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS60910.1| hypothetical protein M569_13891 [Genlisea aurea] 64 9e-10 gb|KVH99882.1| ENTH/VHS-like protein [Cynara cardunculus var. sc... 66 2e-08 ref|XP_024166448.1| TOM1-like protein 9 isoform X3 [Rosa chinensis] 66 3e-08 ref|XP_011081815.1| TOM1-like protein 2 [Sesamum indicum] 66 3e-08 ref|XP_024166447.1| TOM1-like protein 9 isoform X2 [Rosa chinensis] 66 3e-08 ref|XP_008378101.1| PREDICTED: target of Myb protein 1-like [Mal... 66 3e-08 ref|XP_024166446.1| TOM1-like protein 9 isoform X1 [Rosa chinens... 66 3e-08 ref|XP_011459005.1| PREDICTED: target of Myb protein 1 [Fragaria... 66 3e-08 ref|XP_021986847.1| TOM1-like protein 9 isoform X1 [Helianthus a... 65 5e-08 gb|OTG38427.1| putative ENTH/VHS/GAT family protein [Helianthus ... 65 5e-08 ref|XP_018505422.1| PREDICTED: target of Myb protein 1 isoform X... 65 5e-08 ref|XP_009367903.1| PREDICTED: target of Myb protein 1 isoform X... 65 5e-08 ref|XP_021819333.1| TOM1-like protein 9 isoform X2 [Prunus avium] 65 6e-08 gb|ONI33880.1| hypothetical protein PRUPE_1G451300 [Prunus persica] 65 6e-08 ref|XP_021819332.1| TOM1-like protein 9 isoform X1 [Prunus avium] 65 7e-08 ref|XP_007225177.1| target of Myb protein 1 [Prunus persica] >gi... 65 7e-08 ref|XP_008220049.1| PREDICTED: target of Myb protein 1 [Prunus m... 65 7e-08 ref|XP_012847296.1| PREDICTED: target of Myb protein 1-like [Ery... 65 8e-08 ref|XP_023741507.1| TOM1-like protein 9 isoform X1 [Lactuca sati... 65 8e-08 ref|XP_022853387.1| TOM1-like protein 9 [Olea europaea var. sylv... 65 8e-08 >gb|EPS60910.1| hypothetical protein M569_13891 [Genlisea aurea] Length = 65 Score = 64.3 bits (155), Expect = 9e-10 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -2 Query: 86 GPDWAMNIEICDICNHDPVQAKDVVKGI 3 GPDWAMNIEICD+CNHDP QAKDVVKGI Sbjct: 16 GPDWAMNIEICDVCNHDPAQAKDVVKGI 43 >gb|KVH99882.1| ENTH/VHS-like protein [Cynara cardunculus var. scolymus] Length = 569 Score = 66.2 bits (160), Expect = 2e-08 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -2 Query: 86 GPDWAMNIEICDICNHDPVQAKDVVKGI 3 GPDWAMNIEICDICNHDPVQAKDVVKGI Sbjct: 16 GPDWAMNIEICDICNHDPVQAKDVVKGI 43 >ref|XP_024166448.1| TOM1-like protein 9 isoform X3 [Rosa chinensis] Length = 635 Score = 66.2 bits (160), Expect = 3e-08 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -2 Query: 86 GPDWAMNIEICDICNHDPVQAKDVVKGI 3 GPDWAMNIEICDICNHDPVQAKDVVKGI Sbjct: 16 GPDWAMNIEICDICNHDPVQAKDVVKGI 43 >ref|XP_011081815.1| TOM1-like protein 2 [Sesamum indicum] Length = 651 Score = 66.2 bits (160), Expect = 3e-08 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -2 Query: 86 GPDWAMNIEICDICNHDPVQAKDVVKGI 3 GPDWAMNIEICDICNHDPVQAKDVVKGI Sbjct: 16 GPDWAMNIEICDICNHDPVQAKDVVKGI 43 >ref|XP_024166447.1| TOM1-like protein 9 isoform X2 [Rosa chinensis] Length = 673 Score = 66.2 bits (160), Expect = 3e-08 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -2 Query: 86 GPDWAMNIEICDICNHDPVQAKDVVKGI 3 GPDWAMNIEICDICNHDPVQAKDVVKGI Sbjct: 16 GPDWAMNIEICDICNHDPVQAKDVVKGI 43 >ref|XP_008378101.1| PREDICTED: target of Myb protein 1-like [Malus domestica] Length = 704 Score = 66.2 bits (160), Expect = 3e-08 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -2 Query: 86 GPDWAMNIEICDICNHDPVQAKDVVKGI 3 GPDWAMNIEICDICNHDPVQAKDVVKGI Sbjct: 16 GPDWAMNIEICDICNHDPVQAKDVVKGI 43 >ref|XP_024166446.1| TOM1-like protein 9 isoform X1 [Rosa chinensis] gb|PRQ27492.1| putative target of Myb protein [Rosa chinensis] Length = 706 Score = 66.2 bits (160), Expect = 3e-08 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -2 Query: 86 GPDWAMNIEICDICNHDPVQAKDVVKGI 3 GPDWAMNIEICDICNHDPVQAKDVVKGI Sbjct: 16 GPDWAMNIEICDICNHDPVQAKDVVKGI 43 >ref|XP_011459005.1| PREDICTED: target of Myb protein 1 [Fragaria vesca subsp. vesca] Length = 707 Score = 66.2 bits (160), Expect = 3e-08 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -2 Query: 86 GPDWAMNIEICDICNHDPVQAKDVVKGI 3 GPDWAMNIEICDICNHDPVQAKDVVKGI Sbjct: 16 GPDWAMNIEICDICNHDPVQAKDVVKGI 43 >ref|XP_021986847.1| TOM1-like protein 9 isoform X1 [Helianthus annuus] Length = 640 Score = 65.5 bits (158), Expect = 5e-08 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -2 Query: 86 GPDWAMNIEICDICNHDPVQAKDVVKGI 3 GPDWAMN+EICDICNHDPVQAKDVVKGI Sbjct: 16 GPDWAMNLEICDICNHDPVQAKDVVKGI 43 >gb|OTG38427.1| putative ENTH/VHS/GAT family protein [Helianthus annuus] Length = 644 Score = 65.5 bits (158), Expect = 5e-08 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -2 Query: 86 GPDWAMNIEICDICNHDPVQAKDVVKGI 3 GPDWAMN+EICDICNHDPVQAKDVVKGI Sbjct: 16 GPDWAMNLEICDICNHDPVQAKDVVKGI 43 >ref|XP_018505422.1| PREDICTED: target of Myb protein 1 isoform X2 [Pyrus x bretschneideri] Length = 680 Score = 65.5 bits (158), Expect = 5e-08 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -2 Query: 86 GPDWAMNIEICDICNHDPVQAKDVVKGI 3 GPDWAMN+EICDICNHDPVQAKDVVKGI Sbjct: 16 GPDWAMNLEICDICNHDPVQAKDVVKGI 43 >ref|XP_009367903.1| PREDICTED: target of Myb protein 1 isoform X1 [Pyrus x bretschneideri] Length = 701 Score = 65.5 bits (158), Expect = 5e-08 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -2 Query: 86 GPDWAMNIEICDICNHDPVQAKDVVKGI 3 GPDWAMN+EICDICNHDPVQAKDVVKGI Sbjct: 16 GPDWAMNLEICDICNHDPVQAKDVVKGI 43 >ref|XP_021819333.1| TOM1-like protein 9 isoform X2 [Prunus avium] Length = 676 Score = 65.1 bits (157), Expect = 6e-08 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -2 Query: 86 GPDWAMNIEICDICNHDPVQAKDVVKGI 3 GPDWAMNIEICD+CNHDPVQAKDVVKGI Sbjct: 16 GPDWAMNIEICDMCNHDPVQAKDVVKGI 43 >gb|ONI33880.1| hypothetical protein PRUPE_1G451300 [Prunus persica] Length = 676 Score = 65.1 bits (157), Expect = 6e-08 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -2 Query: 86 GPDWAMNIEICDICNHDPVQAKDVVKGI 3 GPDWAMNIEICD+CNHDPVQAKDVVKGI Sbjct: 16 GPDWAMNIEICDMCNHDPVQAKDVVKGI 43 >ref|XP_021819332.1| TOM1-like protein 9 isoform X1 [Prunus avium] Length = 697 Score = 65.1 bits (157), Expect = 7e-08 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -2 Query: 86 GPDWAMNIEICDICNHDPVQAKDVVKGI 3 GPDWAMNIEICD+CNHDPVQAKDVVKGI Sbjct: 16 GPDWAMNIEICDMCNHDPVQAKDVVKGI 43 >ref|XP_007225177.1| target of Myb protein 1 [Prunus persica] gb|ONI33881.1| hypothetical protein PRUPE_1G451300 [Prunus persica] Length = 697 Score = 65.1 bits (157), Expect = 7e-08 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -2 Query: 86 GPDWAMNIEICDICNHDPVQAKDVVKGI 3 GPDWAMNIEICD+CNHDPVQAKDVVKGI Sbjct: 16 GPDWAMNIEICDMCNHDPVQAKDVVKGI 43 >ref|XP_008220049.1| PREDICTED: target of Myb protein 1 [Prunus mume] Length = 699 Score = 65.1 bits (157), Expect = 7e-08 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -2 Query: 86 GPDWAMNIEICDICNHDPVQAKDVVKGI 3 GPDWAMNIEICD+CNHDPVQAKDVVKGI Sbjct: 16 GPDWAMNIEICDMCNHDPVQAKDVVKGI 43 >ref|XP_012847296.1| PREDICTED: target of Myb protein 1-like [Erythranthe guttata] ref|XP_012847297.1| PREDICTED: target of Myb protein 1-like [Erythranthe guttata] gb|EYU29271.1| hypothetical protein MIMGU_mgv1a004368mg [Erythranthe guttata] Length = 531 Score = 64.7 bits (156), Expect = 8e-08 Identities = 32/46 (69%), Positives = 35/46 (76%), Gaps = 2/46 (4%) Frame = -2 Query: 134 LNPAVNRYV--MIIAHKHGPDWAMNIEICDICNHDPVQAKDVVKGI 3 +NP V R M+I GPDWAMNIEICDICNHDP QAKDVV+GI Sbjct: 2 VNPMVERATSDMLI----GPDWAMNIEICDICNHDPAQAKDVVRGI 43 >ref|XP_023741507.1| TOM1-like protein 9 isoform X1 [Lactuca sativa] gb|PLY67905.1| hypothetical protein LSAT_1X49720 [Lactuca sativa] Length = 633 Score = 64.7 bits (156), Expect = 8e-08 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -2 Query: 86 GPDWAMNIEICDICNHDPVQAKDVVKGI 3 GPDWAMNIEICDICNHDPVQAK+VVKGI Sbjct: 16 GPDWAMNIEICDICNHDPVQAKEVVKGI 43 >ref|XP_022853387.1| TOM1-like protein 9 [Olea europaea var. sylvestris] Length = 644 Score = 64.7 bits (156), Expect = 8e-08 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = -2 Query: 86 GPDWAMNIEICDICNHDPVQAKDVVKGI 3 GPDWAMNIEICDICNHDP QAKDVVKGI Sbjct: 16 GPDWAMNIEICDICNHDPAQAKDVVKGI 43