BLASTX nr result
ID: Chrysanthemum22_contig00030397
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00030397 (650 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023736567.1| guanine nucleotide exchange factor SPIKE 1 i... 62 2e-07 ref|XP_023736568.1| guanine nucleotide exchange factor SPIKE 1 i... 59 2e-06 >ref|XP_023736567.1| guanine nucleotide exchange factor SPIKE 1 isoform X1 [Lactuca sativa] Length = 1836 Score = 61.6 bits (148), Expect = 2e-07 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +3 Query: 555 LIKATENMSSNGHCFRRKPRQPVAANLNVDSL 650 LI ATE MSSNGHCFRRKPRQPVAANL++DSL Sbjct: 11 LIAATEKMSSNGHCFRRKPRQPVAANLDIDSL 42 >ref|XP_023736568.1| guanine nucleotide exchange factor SPIKE 1 isoform X2 [Lactuca sativa] Length = 1824 Score = 58.9 bits (141), Expect = 2e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +3 Query: 564 ATENMSSNGHCFRRKPRQPVAANLNVDSL 650 ATE MSSNGHCFRRKPRQPVAANL++DSL Sbjct: 2 ATEKMSSNGHCFRRKPRQPVAANLDIDSL 30