BLASTX nr result
ID: Chrysanthemum22_contig00030272
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00030272 (365 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVH88006.1| Plant specific Rop nucleotide exchanger, PRONE [C... 65 1e-09 >gb|KVH88006.1| Plant specific Rop nucleotide exchanger, PRONE [Cynara cardunculus var. scolymus] Length = 541 Score = 64.7 bits (156), Expect = 1e-09 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +3 Query: 51 EVTQSCKLDSKISADLDRPWTYAAGKVPANAPERH 155 E QSCKLD +SADLDRPWTYAAG +P+NAPERH Sbjct: 507 EAAQSCKLDGSMSADLDRPWTYAAGNLPSNAPERH 541