BLASTX nr result
ID: Chrysanthemum22_contig00029901
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00029901 (450 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012436595.1| PREDICTED: arginine--tRNA ligase, cytoplasmi... 53 4e-06 >ref|XP_012436595.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X1 [Gossypium raimondii] ref|XP_012436596.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X1 [Gossypium raimondii] gb|KJB47990.1| hypothetical protein B456_008G049500 [Gossypium raimondii] Length = 118 Score = 53.1 bits (126), Expect = 4e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -2 Query: 446 EETSRLLLCEAAEMVMRKCFDLLGITPICK 357 +ETSRLLLCEA MVMRKCF+LLGITPI K Sbjct: 88 KETSRLLLCEATAMVMRKCFNLLGITPIYK 117