BLASTX nr result
ID: Chrysanthemum22_contig00029717
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00029717 (437 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023756241.1| uncharacterized protein LOC111904744 isoform... 56 2e-06 ref|XP_023756239.1| uncharacterized protein LOC111904744 isoform... 56 2e-06 >ref|XP_023756241.1| uncharacterized protein LOC111904744 isoform X2 [Lactuca sativa] gb|PLY91111.1| hypothetical protein LSAT_0X6020 [Lactuca sativa] Length = 339 Score = 56.2 bits (134), Expect = 2e-06 Identities = 25/40 (62%), Positives = 32/40 (80%) Frame = -1 Query: 134 MSEISRDVNAASMMNMGPDMFQYYISSLSELLYRDDFAPT 15 MSEISRD+N + N+GPD+FQYYI +SELL DDF+P+ Sbjct: 1 MSEISRDMNTSDDSNIGPDLFQYYIRGVSELLSGDDFSPS 40 >ref|XP_023756239.1| uncharacterized protein LOC111904744 isoform X1 [Lactuca sativa] ref|XP_023756240.1| uncharacterized protein LOC111904744 isoform X1 [Lactuca sativa] Length = 354 Score = 56.2 bits (134), Expect = 2e-06 Identities = 25/40 (62%), Positives = 32/40 (80%) Frame = -1 Query: 134 MSEISRDVNAASMMNMGPDMFQYYISSLSELLYRDDFAPT 15 MSEISRD+N + N+GPD+FQYYI +SELL DDF+P+ Sbjct: 1 MSEISRDMNTSDDSNIGPDLFQYYIRGVSELLSGDDFSPS 40