BLASTX nr result
ID: Chrysanthemum22_contig00029547
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00029547 (391 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PHT59831.1| hypothetical protein CQW23_02194 [Capsicum baccatum] 55 4e-06 gb|PHT94568.1| Protein translocase subunit SecA, chloroplastic [... 55 4e-06 >gb|PHT59831.1| hypothetical protein CQW23_02194 [Capsicum baccatum] Length = 447 Score = 55.1 bits (131), Expect = 4e-06 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = +1 Query: 133 KSLLLKDVNYIIHGKEVLIVDEFSGRVMQVIDSY 234 K L LKDVNYII GKEVLIVDEF+GRVMQ + S+ Sbjct: 392 KELFLKDVNYIIRGKEVLIVDEFTGRVMQALKSH 425 >gb|PHT94568.1| Protein translocase subunit SecA, chloroplastic [Capsicum annuum] Length = 471 Score = 55.1 bits (131), Expect = 4e-06 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = +1 Query: 133 KSLLLKDVNYIIHGKEVLIVDEFSGRVMQVIDSY 234 K L LKDVNYII GKEVLIVDEF+GRVMQ + S+ Sbjct: 416 KELFLKDVNYIIRGKEVLIVDEFTGRVMQALKSH 449