BLASTX nr result
ID: Chrysanthemum22_contig00029276
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00029276 (373 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJB09735.1| hypothetical protein B456_001G161100 [Gossypium r... 144 1e-40 ref|XP_003628497.1| NADH-ubiquinone oxidoreductase (complex I), ... 109 1e-27 ref|XP_013442841.1| hypothetical protein MTR_0082s0270 [Medicago... 91 4e-20 ref|YP_009381502.1| hypothetical protein AEK19_MT1089 (mitochond... 72 2e-14 gb|OMP00389.1| hypothetical protein CCACVL1_03358 [Corchorus cap... 61 1e-09 gb|PNX69752.1| NADH dehydrogenase subunit F, partial [Trifolium ... 59 2e-09 gb|PNY07360.1| NADH dehydrogenase subunit 1 [Trifolium pratense] 59 8e-08 emb|CAN61461.1| hypothetical protein VITISV_029800 [Vitis vinifera] 54 1e-06 >gb|KJB09735.1| hypothetical protein B456_001G161100 [Gossypium raimondii] Length = 250 Score = 144 bits (363), Expect = 1e-40 Identities = 71/76 (93%), Positives = 72/76 (94%) Frame = -3 Query: 329 AWLILSEKKVGFGGSLISTPPVLVRSGPWSYVSGLPAYLLSEIDQPAGLVWLFFSIEKES 150 AWLILSEKKVGFGGSLISTPPVLVRSGPWS VSGLPA +SEIDQPAGLVWLF SIEKES Sbjct: 53 AWLILSEKKVGFGGSLISTPPVLVRSGPWSSVSGLPADKISEIDQPAGLVWLFLSIEKES 112 Query: 149 AVCASHLLLGSAGRHG 102 AVCASHLLLGSAGRHG Sbjct: 113 AVCASHLLLGSAGRHG 128 >ref|XP_003628497.1| NADH-ubiquinone oxidoreductase (complex I), chain 5 [Medicago truncatula] gb|AET02973.1| NADH-ubiquinone oxidoreductase (complex I), chain 5 [Medicago truncatula] Length = 187 Score = 109 bits (273), Expect = 1e-27 Identities = 55/66 (83%), Positives = 58/66 (87%), Gaps = 1/66 (1%) Frame = -3 Query: 290 GSLISTPPVLVRSGPWSYVSGLPAYLLSEIDQPAGLVWLFFSIE-KESAVCASHLLLGSA 114 GSLISTPPVL+RSGPWS VSG PA +SEIDQPAGLVWLF SIE KESAVCASHLLLGSA Sbjct: 19 GSLISTPPVLIRSGPWSSVSGFPADKISEIDQPAGLVWLFLSIEKKESAVCASHLLLGSA 78 Query: 113 GRHGIL 96 GRH + Sbjct: 79 GRHAFV 84 >ref|XP_013442841.1| hypothetical protein MTR_0082s0270 [Medicago truncatula] gb|KEH16866.1| hypothetical protein MTR_0082s0270 [Medicago truncatula] Length = 197 Score = 90.5 bits (223), Expect = 4e-20 Identities = 47/59 (79%), Positives = 49/59 (83%), Gaps = 1/59 (1%) Frame = -3 Query: 290 GSLISTPPVLVRSGPWSYVSGLPAYLLSEIDQPAGLVWLFFSIE-KESAVCASHLLLGS 117 GSLISTPPVL+RSGPWS VSGLPA +SEIDQPAGLVWLF SIE KESAVCA GS Sbjct: 37 GSLISTPPVLIRSGPWSSVSGLPADKISEIDQPAGLVWLFLSIEKKESAVCAGRTCDGS 95 >ref|YP_009381502.1| hypothetical protein AEK19_MT1089 (mitochondrion) [Utricularia reniformis] gb|ART31310.1| hypothetical protein AEK19_MT1089 (mitochondrion) [Utricularia reniformis] Length = 55 Score = 72.0 bits (175), Expect = 2e-14 Identities = 39/50 (78%), Positives = 41/50 (82%), Gaps = 4/50 (8%) Frame = -3 Query: 323 LILSEKKVGF----GGSLISTPPVLVRSGPWSYVSGLPAYLLSEIDQPAG 186 +ILSEKKV F SLISTPPVLVRSGPWS VSGLPA L+SEIDQPAG Sbjct: 1 MILSEKKVHFYFWGSCSLISTPPVLVRSGPWSSVSGLPAELISEIDQPAG 50 >gb|OMP00389.1| hypothetical protein CCACVL1_03358 [Corchorus capsularis] Length = 102 Score = 60.8 bits (146), Expect = 1e-09 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -3 Query: 278 STPPVLVRSGPWSYVSGLPAYLLSEIDQPAGL 183 STPPVLVRSGPWS+VSGLPA +SEIDQPAGL Sbjct: 20 STPPVLVRSGPWSFVSGLPADKISEIDQPAGL 51 >gb|PNX69752.1| NADH dehydrogenase subunit F, partial [Trifolium pratense] Length = 46 Score = 58.9 bits (141), Expect = 2e-09 Identities = 30/38 (78%), Positives = 32/38 (84%) Frame = -3 Query: 206 EIDQPAGLVWLFFSIEKESAVCASHLLLGSAGRHGILV 93 EID+PAGLVWLF SIEKES VC S LLGSAG+H ILV Sbjct: 10 EIDKPAGLVWLFLSIEKESVVCTSR-LLGSAGQHRILV 46 >gb|PNY07360.1| NADH dehydrogenase subunit 1 [Trifolium pratense] Length = 301 Score = 59.3 bits (142), Expect = 8e-08 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = +1 Query: 169 KNSQTSPAGWSISERR*AGKPETYDHGPDLTSTG 270 KNSQT+PAGWSISE AGKPET DHGPDL STG Sbjct: 125 KNSQTNPAGWSISEILSAGKPETDDHGPDLISTG 158 >emb|CAN61461.1| hypothetical protein VITISV_029800 [Vitis vinifera] Length = 124 Score = 53.9 bits (128), Expect = 1e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -3 Query: 278 STPPVLVRSGPWSYVSGLPAYLLSEIDQPAGL 183 +TPPVLVRSG WS VSGLPA +SEIDQPAGL Sbjct: 37 TTPPVLVRSGLWSSVSGLPADKISEIDQPAGL 68