BLASTX nr result
ID: Chrysanthemum22_contig00029182
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00029182 (453 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023769995.1| protein RDM16 isoform X2 [Lactuca sativa] 59 2e-07 >ref|XP_023769995.1| protein RDM16 isoform X2 [Lactuca sativa] Length = 621 Score = 59.3 bits (142), Expect = 2e-07 Identities = 24/35 (68%), Positives = 28/35 (80%) Frame = +2 Query: 344 MTTLAVLMLMVAHQDHTVRHLEPHTRPLWHPATIL 448 M T+ V M MV H+DH VRH+EPH RPLWHPAT+L Sbjct: 1 MNTMVVPMPMVVHRDHAVRHMEPHMRPLWHPATLL 35