BLASTX nr result
ID: Chrysanthemum22_contig00029174
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00029174 (369 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVI10623.1| AMP-binding, conserved site-containing protein [C... 58 4e-07 gb|ADV16379.1| long-chain acyl-CoA synthetase 2 [Helianthus annuus] 55 2e-06 ref|XP_022036256.1| long chain acyl-CoA synthetase 8 [Helianthus... 55 2e-06 >gb|KVI10623.1| AMP-binding, conserved site-containing protein [Cynara cardunculus var. scolymus] Length = 680 Score = 57.8 bits (138), Expect = 4e-07 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +3 Query: 249 SFLEVEKMGQETPVPVRLPIKKDVAVIMYTSGS 347 SF EVEKMG++ PVP +LPIKKD+AVIMYTSGS Sbjct: 260 SFTEVEKMGKKNPVPAKLPIKKDIAVIMYTSGS 292 >gb|ADV16379.1| long-chain acyl-CoA synthetase 2 [Helianthus annuus] Length = 711 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +3 Query: 249 SFLEVEKMGQETPVPVRLPIKKDVAVIMYTSGS 347 SF EVEKMG+ +PV RLPIKKD+AVIMYTSGS Sbjct: 244 SFSEVEKMGRNSPVKARLPIKKDIAVIMYTSGS 276 >ref|XP_022036256.1| long chain acyl-CoA synthetase 8 [Helianthus annuus] gb|OTG29824.1| putative AMP-dependent synthetase and ligase family protein [Helianthus annuus] Length = 720 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +3 Query: 249 SFLEVEKMGQETPVPVRLPIKKDVAVIMYTSGS 347 SF EVEKMG+ +PV RLPIKKD+AVIMYTSGS Sbjct: 253 SFSEVEKMGRNSPVKARLPIKKDIAVIMYTSGS 285