BLASTX nr result
ID: Chrysanthemum22_contig00029142
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00029142 (567 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAY44359.1| hypothetical protein CUMW_081560 [Citrus unshiu] 53 3e-06 >dbj|GAY44359.1| hypothetical protein CUMW_081560 [Citrus unshiu] Length = 790 Score = 53.1 bits (126), Expect(2) = 3e-06 Identities = 25/35 (71%), Positives = 28/35 (80%) Frame = -1 Query: 549 KSILNKLTPEKFDLFKGQLIDLGIATTNILMITFT 445 K ILNKLTPEKFD+ KGQLID GI T +IL +T T Sbjct: 203 KGILNKLTPEKFDVLKGQLIDSGITTPDILKVTIT 237 Score = 25.4 bits (54), Expect(2) = 3e-06 Identities = 14/40 (35%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Frame = -3 Query: 412 RVTHKIRKLHNIMHGAYPCYLTE--LEPTLCLVCAELCSN 299 +VT + HN++ G + LEPT C + A LCS+ Sbjct: 233 KVTITHLECHNLLQGVIELIFDKAVLEPTFCPMYALLCSD 272