BLASTX nr result
ID: Chrysanthemum22_contig00029076
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00029076 (684 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OTG17309.1| putative tyrosine-protein kinase, non-receptor Ja... 84 2e-17 gb|KVI04991.1| Apple-like protein [Cynara cardunculus var. scoly... 91 3e-17 gb|KVI04988.1| Apple-like protein, partial [Cynara cardunculus v... 91 4e-17 gb|OTG18074.1| putative serine/threonine/dual specificity protei... 88 9e-17 ref|XP_021993170.1| G-type lectin S-receptor-like serine/threoni... 87 1e-16 ref|XP_021993169.1| G-type lectin S-receptor-like serine/threoni... 87 1e-16 ref|XP_021976980.1| G-type lectin S-receptor-like serine/threoni... 88 2e-16 ref|XP_021976979.1| G-type lectin S-receptor-like serine/threoni... 88 2e-16 ref|XP_021976974.1| G-type lectin S-receptor-like serine/threoni... 85 3e-16 gb|OTG07572.1| putative S-locus glycoprotein domain-containing p... 87 4e-16 gb|OTG07573.1| putative S-locus glycoprotein domain-containing p... 87 4e-16 gb|OTG04948.1| putative ephrin type-A receptor 8 [Helianthus ann... 82 5e-16 ref|XP_021976978.1| G-type lectin S-receptor-like serine/threoni... 87 5e-16 ref|XP_021976977.1| G-type lectin S-receptor-like serine/threoni... 87 5e-16 ref|XP_021976987.1| G-type lectin S-receptor-like serine/threoni... 84 2e-15 ref|XP_021976986.1| G-type lectin S-receptor-like serine/threoni... 84 2e-15 ref|XP_021976972.1| G-type lectin S-receptor-like serine/threoni... 85 2e-15 ref|XP_021976971.1| G-type lectin S-receptor-like serine/threoni... 85 2e-15 gb|OTG26438.1| putative S-locus glycoprotein domain-containing p... 85 3e-15 gb|OTG26440.1| putative S-locus glycoprotein domain-containing p... 85 3e-15 >gb|OTG17309.1| putative tyrosine-protein kinase, non-receptor Jak2 [Helianthus annuus] gb|OTG17355.1| putative tyrosine-protein kinase, neurotrophic receptor [Helianthus annuus] Length = 96 Score = 84.3 bits (207), Expect = 2e-17 Identities = 38/54 (70%), Positives = 44/54 (81%) Frame = +3 Query: 165 SGYISPEYVVHRRFSIKSHVFSFGVMVLEMVSGMKNRELCHEDNRDNLFGHGYR 326 SGYISPEY +H RFSIKS V+SFGV+VLE+VSG KNRE H+D DNL GH +R Sbjct: 7 SGYISPEYAIHGRFSIKSDVYSFGVLVLEIVSGKKNREFSHDDYNDNLLGHAWR 60 >gb|KVI04991.1| Apple-like protein [Cynara cardunculus var. scolymus] Length = 817 Score = 90.9 bits (224), Expect = 3e-17 Identities = 42/53 (79%), Positives = 46/53 (86%) Frame = +3 Query: 168 GYISPEYVVHRRFSIKSHVFSFGVMVLEMVSGMKNRELCHEDNRDNLFGHGYR 326 GYISPEY VH RFSIKS VFSFGV+VLE+VSGMKNRE HED+RDNL GH +R Sbjct: 673 GYISPEYAVHGRFSIKSDVFSFGVLVLEIVSGMKNREFSHEDHRDNLLGHAWR 725 >gb|KVI04988.1| Apple-like protein, partial [Cynara cardunculus var. scolymus] Length = 2947 Score = 90.5 bits (223), Expect = 4e-17 Identities = 42/54 (77%), Positives = 46/54 (85%) Frame = +3 Query: 165 SGYISPEYVVHRRFSIKSHVFSFGVMVLEMVSGMKNRELCHEDNRDNLFGHGYR 326 SGYISPEY VH RFS KS VFSFGV+VLE+VSG KNRE HED+RDNL GHG+R Sbjct: 1446 SGYISPEYAVHGRFSTKSDVFSFGVLVLEIVSGKKNREFSHEDHRDNLLGHGWR 1499 Score = 84.7 bits (208), Expect = 4e-15 Identities = 39/53 (73%), Positives = 43/53 (81%) Frame = +3 Query: 168 GYISPEYVVHRRFSIKSHVFSFGVMVLEMVSGMKNRELCHEDNRDNLFGHGYR 326 GYISPEY VH RFS+KS VFSFGV+VLEMVSG KNR HED+ DNL GH +R Sbjct: 652 GYISPEYAVHGRFSVKSDVFSFGVLVLEMVSGKKNRGFSHEDHSDNLLGHAWR 704 Score = 81.3 bits (199), Expect = 6e-14 Identities = 37/50 (74%), Positives = 41/50 (82%) Frame = +3 Query: 168 GYISPEYVVHRRFSIKSHVFSFGVMVLEMVSGMKNRELCHEDNRDNLFGH 317 GYISPEY VH RFS+KS VFSFGV+VLEMVSG KNR H+D+ DNL GH Sbjct: 1893 GYISPEYAVHXRFSVKSDVFSFGVLVLEMVSGKKNRGFSHDDHSDNLLGH 1942 Score = 80.9 bits (198), Expect = 8e-14 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +3 Query: 168 GYISPEYVVHRRFSIKSHVFSFGVMVLEMVSGMKNRELCHEDNRDNLFGHGYR 326 GYISPEY VH RFSIKS VFSFGV+VLE+VSG KNR H D+ DNL GH +R Sbjct: 2667 GYISPEYAVHGRFSIKSDVFSFGVLVLEIVSGKKNRGFSHGDHSDNLLGHAWR 2719 Score = 60.1 bits (144), Expect = 1e-06 Identities = 28/42 (66%), Positives = 33/42 (78%) Frame = +3 Query: 192 VHRRFSIKSHVFSFGVMVLEMVSGMKNRELCHEDNRDNLFGH 317 VH +FS+KS V SF ++VLEMVSG KNRE HED+ DNL GH Sbjct: 793 VHGQFSVKSDVLSFCLLVLEMVSGKKNREFYHEDHDDNLLGH 834 >gb|OTG18074.1| putative serine/threonine/dual specificity protein kinase, catalytic domain-containing protein [Helianthus annuus] Length = 335 Score = 87.8 bits (216), Expect = 9e-17 Identities = 39/53 (73%), Positives = 44/53 (83%) Frame = +3 Query: 168 GYISPEYVVHRRFSIKSHVFSFGVMVLEMVSGMKNRELCHEDNRDNLFGHGYR 326 GYISPEY VH RFSIKS V+SFGV+VLE+VSG KNRE CH+D DNL GH +R Sbjct: 191 GYISPEYAVHGRFSIKSDVYSFGVLVLEIVSGRKNREFCHDDRNDNLLGHAWR 243 >ref|XP_021993170.1| G-type lectin S-receptor-like serine/threonine-protein kinase SD1-1 [Helianthus annuus] Length = 333 Score = 87.4 bits (215), Expect = 1e-16 Identities = 38/53 (71%), Positives = 44/53 (83%) Frame = +3 Query: 168 GYISPEYVVHRRFSIKSHVFSFGVMVLEMVSGMKNRELCHEDNRDNLFGHGYR 326 GYISPEY +H RFSIKS V+SFGV+VLE+VSG KNRE CH+D DNL GH +R Sbjct: 189 GYISPEYAIHGRFSIKSDVYSFGVLVLEIVSGKKNREFCHDDRNDNLLGHAWR 241 >ref|XP_021993169.1| G-type lectin S-receptor-like serine/threonine-protein kinase SD1-1 [Helianthus annuus] Length = 333 Score = 87.4 bits (215), Expect = 1e-16 Identities = 38/53 (71%), Positives = 44/53 (83%) Frame = +3 Query: 168 GYISPEYVVHRRFSIKSHVFSFGVMVLEMVSGMKNRELCHEDNRDNLFGHGYR 326 GYISPEY +H RFSIKS V+SFGV+VLE+VSG KNRE CH+D DNL GH +R Sbjct: 189 GYISPEYAIHGRFSIKSDVYSFGVLVLEIVSGKKNREFCHDDRNDNLLGHAWR 241 >ref|XP_021976980.1| G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290 isoform X2 [Helianthus annuus] Length = 463 Score = 87.8 bits (216), Expect = 2e-16 Identities = 39/53 (73%), Positives = 44/53 (83%) Frame = +3 Query: 168 GYISPEYVVHRRFSIKSHVFSFGVMVLEMVSGMKNRELCHEDNRDNLFGHGYR 326 GYISPEY VH RFSIKS V+SFGV+VLE+VSG KNRE CH+D DNL GH +R Sbjct: 319 GYISPEYAVHGRFSIKSDVYSFGVLVLEIVSGRKNREFCHDDRNDNLLGHAWR 371 >ref|XP_021976979.1| G-type lectin S-receptor-like serine/threonine-protein kinase SD1-1 isoform X1 [Helianthus annuus] Length = 511 Score = 87.8 bits (216), Expect = 2e-16 Identities = 39/53 (73%), Positives = 44/53 (83%) Frame = +3 Query: 168 GYISPEYVVHRRFSIKSHVFSFGVMVLEMVSGMKNRELCHEDNRDNLFGHGYR 326 GYISPEY VH RFSIKS V+SFGV+VLE+VSG KNRE CH+D DNL GH +R Sbjct: 367 GYISPEYAVHGRFSIKSDVYSFGVLVLEIVSGRKNREFCHDDRNDNLLGHAWR 419 >ref|XP_021976974.1| G-type lectin S-receptor-like serine/threonine-protein kinase SD1-1 [Helianthus annuus] gb|OTG18068.1| putative protein kinase-like domain-containing protein [Helianthus annuus] Length = 236 Score = 84.7 bits (208), Expect = 3e-16 Identities = 36/53 (67%), Positives = 44/53 (83%) Frame = +3 Query: 168 GYISPEYVVHRRFSIKSHVFSFGVMVLEMVSGMKNRELCHEDNRDNLFGHGYR 326 GYISPEY +H +FSIKS V+SFGV+VLE+VSG KNRE CH+D DNL GH ++ Sbjct: 92 GYISPEYAIHGQFSIKSDVYSFGVLVLEIVSGRKNREFCHDDRNDNLLGHAWK 144 >gb|OTG07572.1| putative S-locus glycoprotein domain-containing protein [Helianthus annuus] Length = 807 Score = 87.4 bits (215), Expect = 4e-16 Identities = 38/53 (71%), Positives = 44/53 (83%) Frame = +3 Query: 168 GYISPEYVVHRRFSIKSHVFSFGVMVLEMVSGMKNRELCHEDNRDNLFGHGYR 326 GYISPEY +H RFSIKS V+SFGV+VLE+VSG KNRE CH+D DNL GH +R Sbjct: 663 GYISPEYAIHGRFSIKSDVYSFGVLVLEIVSGKKNREFCHDDRNDNLLGHAWR 715 >gb|OTG07573.1| putative S-locus glycoprotein domain-containing protein [Helianthus annuus] Length = 823 Score = 87.4 bits (215), Expect = 4e-16 Identities = 38/53 (71%), Positives = 44/53 (83%) Frame = +3 Query: 168 GYISPEYVVHRRFSIKSHVFSFGVMVLEMVSGMKNRELCHEDNRDNLFGHGYR 326 GYISPEY +H RFSIKS V+SFGV+VLE+VSG KNRE CH+D DNL GH +R Sbjct: 679 GYISPEYAIHGRFSIKSDVYSFGVLVLEIVSGKKNREFCHDDRNDNLLGHAWR 731 >gb|OTG04948.1| putative ephrin type-A receptor 8 [Helianthus annuus] Length = 152 Score = 82.0 bits (201), Expect = 5e-16 Identities = 37/54 (68%), Positives = 43/54 (79%) Frame = +3 Query: 165 SGYISPEYVVHRRFSIKSHVFSFGVMVLEMVSGMKNRELCHEDNRDNLFGHGYR 326 SGYISPEY VH RFSIKS VFSFGV+VLE++ G KN+E H D+ DNL GH +R Sbjct: 7 SGYISPEYAVHGRFSIKSDVFSFGVLVLEIICGKKNKEFSHGDHNDNLLGHAWR 60 >ref|XP_021976978.1| G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290 isoform X2 [Helianthus annuus] gb|OTG18079.1| putative S-locus glycoprotein domain-containing protein [Helianthus annuus] Length = 820 Score = 87.0 bits (214), Expect = 5e-16 Identities = 37/53 (69%), Positives = 44/53 (83%) Frame = +3 Query: 168 GYISPEYVVHRRFSIKSHVFSFGVMVLEMVSGMKNRELCHEDNRDNLFGHGYR 326 GYISPEY +H RFS+KS V+SFGV+VLE+VSG KNRE CH+D DNL GH +R Sbjct: 676 GYISPEYAIHGRFSVKSDVYSFGVLVLEIVSGKKNREFCHDDRNDNLLGHAWR 728 >ref|XP_021976977.1| G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290 isoform X1 [Helianthus annuus] Length = 821 Score = 87.0 bits (214), Expect = 5e-16 Identities = 37/53 (69%), Positives = 44/53 (83%) Frame = +3 Query: 168 GYISPEYVVHRRFSIKSHVFSFGVMVLEMVSGMKNRELCHEDNRDNLFGHGYR 326 GYISPEY +H RFS+KS V+SFGV+VLE+VSG KNRE CH+D DNL GH +R Sbjct: 677 GYISPEYAIHGRFSVKSDVYSFGVLVLEIVSGKKNREFCHDDRNDNLLGHAWR 729 >ref|XP_021976987.1| G-type lectin S-receptor-like serine/threonine-protein kinase SD1-1 isoform X2 [Helianthus annuus] Length = 364 Score = 84.3 bits (207), Expect = 2e-15 Identities = 38/53 (71%), Positives = 44/53 (83%) Frame = +3 Query: 168 GYISPEYVVHRRFSIKSHVFSFGVMVLEMVSGMKNRELCHEDNRDNLFGHGYR 326 GYISPEY VH RFSIKS V+SFGV+VLE+VSG KNRE H+D+ DNL GH +R Sbjct: 220 GYISPEYAVHGRFSIKSDVYSFGVLVLEIVSGRKNREFSHDDHNDNLLGHAWR 272 >ref|XP_021976986.1| G-type lectin S-receptor-like serine/threonine-protein kinase SD1-1 isoform X1 [Helianthus annuus] Length = 365 Score = 84.3 bits (207), Expect = 2e-15 Identities = 38/53 (71%), Positives = 44/53 (83%) Frame = +3 Query: 168 GYISPEYVVHRRFSIKSHVFSFGVMVLEMVSGMKNRELCHEDNRDNLFGHGYR 326 GYISPEY VH RFSIKS V+SFGV+VLE+VSG KNRE H+D+ DNL GH +R Sbjct: 221 GYISPEYAVHGRFSIKSDVYSFGVLVLEIVSGRKNREFSHDDHNDNLLGHAWR 273 >ref|XP_021976972.1| G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290 isoform X2 [Helianthus annuus] Length = 821 Score = 85.1 bits (209), Expect = 2e-15 Identities = 40/53 (75%), Positives = 43/53 (81%) Frame = +3 Query: 168 GYISPEYVVHRRFSIKSHVFSFGVMVLEMVSGMKNRELCHEDNRDNLFGHGYR 326 GYI PEY VH RFSIKS VFSFGVMVLE+VSG KNRE HED+ DNL GH +R Sbjct: 677 GYIPPEYAVHGRFSIKSDVFSFGVMVLEIVSGKKNREFSHEDHNDNLLGHTWR 729 >ref|XP_021976971.1| G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290 isoform X1 [Helianthus annuus] gb|OTG18063.1| putative GPCR kinase [Helianthus annuus] Length = 822 Score = 85.1 bits (209), Expect = 2e-15 Identities = 40/53 (75%), Positives = 43/53 (81%) Frame = +3 Query: 168 GYISPEYVVHRRFSIKSHVFSFGVMVLEMVSGMKNRELCHEDNRDNLFGHGYR 326 GYI PEY VH RFSIKS VFSFGVMVLE+VSG KNRE HED+ DNL GH +R Sbjct: 678 GYIPPEYAVHGRFSIKSDVFSFGVMVLEIVSGKKNREFSHEDHNDNLLGHTWR 730 >gb|OTG26438.1| putative S-locus glycoprotein domain-containing protein [Helianthus annuus] Length = 804 Score = 84.7 bits (208), Expect = 3e-15 Identities = 38/54 (70%), Positives = 45/54 (83%) Frame = +3 Query: 165 SGYISPEYVVHRRFSIKSHVFSFGVMVLEMVSGMKNRELCHEDNRDNLFGHGYR 326 +GYISPEY VH RFSIKS V+SFGV+VLE+VSG KNRE H+D+ DNL GH +R Sbjct: 659 NGYISPEYAVHGRFSIKSDVYSFGVLVLEIVSGRKNREFSHDDHNDNLLGHAWR 712 >gb|OTG26440.1| putative S-locus glycoprotein domain-containing protein [Helianthus annuus] Length = 820 Score = 84.7 bits (208), Expect = 3e-15 Identities = 37/53 (69%), Positives = 43/53 (81%) Frame = +3 Query: 168 GYISPEYVVHRRFSIKSHVFSFGVMVLEMVSGMKNRELCHEDNRDNLFGHGYR 326 GYISPEY +H RFSIKS V+SFGV+VLE+VSG KNR CH+D DNL GH +R Sbjct: 676 GYISPEYAIHGRFSIKSDVYSFGVLVLEIVSGRKNRVFCHDDRNDNLLGHAWR 728