BLASTX nr result
ID: Chrysanthemum22_contig00029059
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00029059 (1081 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010061099.1| PREDICTED: ribonuclease P protein subunit p2... 50 5e-08 ref|XP_018732277.1| PREDICTED: ribonuclease P protein subunit p2... 50 5e-08 ref|XP_021981440.1| uncharacterized protein LOC110877589 [Helian... 64 9e-08 ref|XP_021992277.1| putative pentatricopeptide repeat-containing... 63 5e-07 ref|XP_012839203.1| PREDICTED: ribonuclease P protein subunit p2... 50 6e-07 ref|XP_021737071.1| myosin heavy chain IB-like [Chenopodium quinoa] 50 8e-07 ref|XP_021756578.1| myosin heavy chain IB-like [Chenopodium quinoa] 50 8e-07 ref|XP_012829561.1| PREDICTED: eukaryotic translation initiation... 50 1e-06 gb|OWM74949.1| hypothetical protein CDL15_Pgr021300 [Punica gran... 50 1e-06 gb|AQK41038.1| Alba DNA/RNA-binding protein [Zea mays] 46 1e-06 ref|XP_003578545.1| PREDICTED: cold and drought-regulated protei... 44 3e-06 gb|PNT65039.1| hypothetical protein BRADI_4g36710v3 [Brachypodiu... 44 3e-06 ref|XP_023770880.1| pentatricopeptide repeat-containing protein ... 60 4e-06 ref|XP_011083442.1| ribonuclease P protein subunit p25-like prot... 49 5e-06 ref|XP_022860191.1| ribonuclease P protein subunit p25-like prot... 49 5e-06 gb|PIN01371.1| hypothetical protein CDL12_26113 [Handroanthus im... 50 9e-06 >ref|XP_010061099.1| PREDICTED: ribonuclease P protein subunit p25-like protein isoform X1 [Eucalyptus grandis] ref|XP_010061100.1| PREDICTED: ribonuclease P protein subunit p25-like protein isoform X1 [Eucalyptus grandis] ref|XP_010061101.1| PREDICTED: ribonuclease P protein subunit p25-like protein isoform X1 [Eucalyptus grandis] ref|XP_018732276.1| PREDICTED: ribonuclease P protein subunit p25-like protein isoform X1 [Eucalyptus grandis] gb|KCW67995.1| hypothetical protein EUGRSUZ_F01689 [Eucalyptus grandis] gb|KCW67996.1| hypothetical protein EUGRSUZ_F01689 [Eucalyptus grandis] gb|KCW67997.1| hypothetical protein EUGRSUZ_F01689 [Eucalyptus grandis] Length = 266 Score = 50.1 bits (118), Expect(2) = 5e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -1 Query: 733 KGSSEIVFKAMGRAINKTVTIVELIK 656 KGS EIVFKAMGRAINKTVTIVELIK Sbjct: 43 KGSKEIVFKAMGRAINKTVTIVELIK 68 Score = 37.0 bits (84), Expect(2) = 5e-08 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -2 Query: 654 TRHVSLITITLSKKELDT 601 TRHVS+ITITLSKKELDT Sbjct: 102 TRHVSMITITLSKKELDT 119 >ref|XP_018732277.1| PREDICTED: ribonuclease P protein subunit p25-like protein isoform X2 [Eucalyptus grandis] Length = 253 Score = 50.1 bits (118), Expect(2) = 5e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -1 Query: 733 KGSSEIVFKAMGRAINKTVTIVELIK 656 KGS EIVFKAMGRAINKTVTIVELIK Sbjct: 43 KGSKEIVFKAMGRAINKTVTIVELIK 68 Score = 37.0 bits (84), Expect(2) = 5e-08 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -2 Query: 654 TRHVSLITITLSKKELDT 601 TRHVS+ITITLSKKELDT Sbjct: 102 TRHVSMITITLSKKELDT 119 >ref|XP_021981440.1| uncharacterized protein LOC110877589 [Helianthus annuus] gb|OTG14103.1| putative alcohol dehydrogenase superfamily, zinc-type [Helianthus annuus] Length = 328 Score = 64.3 bits (155), Expect = 9e-08 Identities = 34/55 (61%), Positives = 38/55 (69%) Frame = -1 Query: 514 SKSVMGTYIEKHIAVAYKAMSLFPIDPFAVAFVMAKGLTARFHVKTWLKGEQPHR 350 S S MGTY E+ I +A KAM L IDP VA VM KGLTARF V+TW K EQ H+ Sbjct: 88 SGSAMGTYTEEQIVLADKAMVLPVIDPLIVASVMVKGLTARFLVRTWFKVEQGHK 142 >ref|XP_021992277.1| putative pentatricopeptide repeat-containing protein At5g52630 [Helianthus annuus] ref|XP_021992278.1| putative pentatricopeptide repeat-containing protein At5g52630 [Helianthus annuus] gb|OTG06541.1| putative tetratricopeptide-like helical domain, DYW domain protein [Helianthus annuus] Length = 564 Score = 62.8 bits (151), Expect = 5e-07 Identities = 24/27 (88%), Positives = 27/27 (100%) Frame = -1 Query: 1081 VDREIIVRDVNRYHRFLDGGCNCGDFW 1001 V+REI+VRDVNRYHRFLDGGCNCGD+W Sbjct: 538 VEREIVVRDVNRYHRFLDGGCNCGDYW 564 >ref|XP_012839203.1| PREDICTED: ribonuclease P protein subunit p25-like protein [Erythranthe guttata] ref|XP_012839204.1| PREDICTED: ribonuclease P protein subunit p25-like protein [Erythranthe guttata] gb|EYU36810.1| hypothetical protein MIMGU_mgv1a012326mg [Erythranthe guttata] Length = 254 Score = 50.1 bits (118), Expect(2) = 6e-07 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -1 Query: 733 KGSSEIVFKAMGRAINKTVTIVELIK 656 KGS EIVFKAMGRAINKTVTIVELIK Sbjct: 43 KGSDEIVFKAMGRAINKTVTIVELIK 68 Score = 33.1 bits (74), Expect(2) = 6e-07 Identities = 15/18 (83%), Positives = 17/18 (94%) Frame = -2 Query: 654 TRHVSLITITLSKKELDT 601 TR VS++TITLSKKELDT Sbjct: 102 TRKVSMVTITLSKKELDT 119 >ref|XP_021737071.1| myosin heavy chain IB-like [Chenopodium quinoa] Length = 263 Score = 50.1 bits (118), Expect(2) = 8e-07 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -1 Query: 733 KGSSEIVFKAMGRAINKTVTIVELIK 656 KGS EIVFKAMGRAINKTVTIVELIK Sbjct: 43 KGSDEIVFKAMGRAINKTVTIVELIK 68 Score = 32.7 bits (73), Expect(2) = 8e-07 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -2 Query: 654 TRHVSLITITLSKKELDT 601 TRHVS+ITITLSK E DT Sbjct: 102 TRHVSMITITLSKNEKDT 119 >ref|XP_021756578.1| myosin heavy chain IB-like [Chenopodium quinoa] Length = 263 Score = 50.1 bits (118), Expect(2) = 8e-07 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -1 Query: 733 KGSSEIVFKAMGRAINKTVTIVELIK 656 KGS EIVFKAMGRAINKTVTIVELIK Sbjct: 43 KGSDEIVFKAMGRAINKTVTIVELIK 68 Score = 32.7 bits (73), Expect(2) = 8e-07 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -2 Query: 654 TRHVSLITITLSKKELDT 601 TRHVS+ITITLSK E DT Sbjct: 102 TRHVSMITITLSKNEKDT 119 >ref|XP_012829561.1| PREDICTED: eukaryotic translation initiation factor 3 subunit A [Erythranthe guttata] gb|EYU17571.1| hypothetical protein MIMGU_mgv1a009326mg [Erythranthe guttata] Length = 345 Score = 50.1 bits (118), Expect(2) = 1e-06 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -1 Query: 733 KGSSEIVFKAMGRAINKTVTIVELIK 656 KGS EIVFKAMGRAINKTVTIVELIK Sbjct: 43 KGSDEIVFKAMGRAINKTVTIVELIK 68 Score = 32.0 bits (71), Expect(2) = 1e-06 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = -2 Query: 654 TRHVSLITITLSKKELDT 601 TR VS++TITLSKK+LDT Sbjct: 102 TRKVSMVTITLSKKDLDT 119 >gb|OWM74949.1| hypothetical protein CDL15_Pgr021300 [Punica granatum] Length = 315 Score = 50.1 bits (118), Expect(2) = 1e-06 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -1 Query: 733 KGSSEIVFKAMGRAINKTVTIVELIK 656 KGS EIVFKAMGRAINKTVTIVELIK Sbjct: 43 KGSDEIVFKAMGRAINKTVTIVELIK 68 Score = 32.0 bits (71), Expect(2) = 1e-06 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = -2 Query: 654 TRHVSLITITLSKKELD 604 TRHVS+ITITLSK +LD Sbjct: 102 TRHVSMITITLSKNQLD 118 >gb|AQK41038.1| Alba DNA/RNA-binding protein [Zea mays] Length = 217 Score = 46.2 bits (108), Expect(2) = 1e-06 Identities = 22/26 (84%), Positives = 24/26 (92%) Frame = -1 Query: 733 KGSSEIVFKAMGRAINKTVTIVELIK 656 KGS E+VFKAMGRAINKTV +VELIK Sbjct: 40 KGSYEVVFKAMGRAINKTVMVVELIK 65 Score = 35.8 bits (81), Expect(2) = 1e-06 Identities = 16/18 (88%), Positives = 18/18 (100%) Frame = -2 Query: 654 TRHVSLITITLSKKELDT 601 TRHVS+ITITLSKKE+DT Sbjct: 96 TRHVSMITITLSKKEVDT 113 >ref|XP_003578545.1| PREDICTED: cold and drought-regulated protein CORA-like [Brachypodium distachyon] gb|KQJ91266.1| hypothetical protein BRADI_4g36710v3 [Brachypodium distachyon] Length = 319 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 21/26 (80%), Positives = 22/26 (84%) Frame = -1 Query: 733 KGSSEIVFKAMGRAINKTVTIVELIK 656 KG E+VFKAMGRAINKTV I ELIK Sbjct: 43 KGCDEVVFKAMGRAINKTVMIAELIK 68 Score = 37.0 bits (84), Expect(2) = 3e-06 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -2 Query: 654 TRHVSLITITLSKKELDT 601 TRHVS+ITITLSKKELDT Sbjct: 102 TRHVSMITITLSKKELDT 119 >gb|PNT65039.1| hypothetical protein BRADI_4g36710v3 [Brachypodium distachyon] Length = 316 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 21/26 (80%), Positives = 22/26 (84%) Frame = -1 Query: 733 KGSSEIVFKAMGRAINKTVTIVELIK 656 KG E+VFKAMGRAINKTV I ELIK Sbjct: 43 KGCDEVVFKAMGRAINKTVMIAELIK 68 Score = 37.0 bits (84), Expect(2) = 3e-06 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -2 Query: 654 TRHVSLITITLSKKELDT 601 TRHVS+ITITLSKKELDT Sbjct: 102 TRHVSMITITLSKKELDT 119 >ref|XP_023770880.1| pentatricopeptide repeat-containing protein At4g33170-like [Lactuca sativa] gb|PLY80040.1| hypothetical protein LSAT_9X42760 [Lactuca sativa] Length = 565 Score = 60.1 bits (144), Expect = 4e-06 Identities = 24/27 (88%), Positives = 25/27 (92%) Frame = -1 Query: 1081 VDREIIVRDVNRYHRFLDGGCNCGDFW 1001 V+REIIVRDVNRYHRF DGGCNCGD W Sbjct: 539 VEREIIVRDVNRYHRFFDGGCNCGDHW 565 >ref|XP_011083442.1| ribonuclease P protein subunit p25-like protein [Sesamum indicum] Length = 251 Score = 48.9 bits (115), Expect(2) = 5e-06 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = -1 Query: 733 KGSSEIVFKAMGRAINKTVTIVELIK 656 KGS +IVFKAMGRAINKTVTIVELIK Sbjct: 43 KGSDDIVFKAMGRAINKTVTIVELIK 68 Score = 31.2 bits (69), Expect(2) = 5e-06 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = -2 Query: 654 TRHVSLITITLSKKELD 604 TR VS++TITLSKKELD Sbjct: 102 TRKVSMVTITLSKKELD 118 >ref|XP_022860191.1| ribonuclease P protein subunit p25-like protein [Olea europaea var. sylvestris] Length = 241 Score = 48.9 bits (115), Expect(2) = 5e-06 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = -1 Query: 733 KGSSEIVFKAMGRAINKTVTIVELIK 656 KGS EI+FKAMGRAINKTVTIVELIK Sbjct: 43 KGSDEILFKAMGRAINKTVTIVELIK 68 Score = 31.2 bits (69), Expect(2) = 5e-06 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -2 Query: 654 TRHVSLITITLSKKELDT 601 TR VS+ITI LSKKELDT Sbjct: 102 TRKVSMITIKLSKKELDT 119 >gb|PIN01371.1| hypothetical protein CDL12_26113 [Handroanthus impetiginosus] Length = 255 Score = 50.1 bits (118), Expect(2) = 9e-06 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -1 Query: 733 KGSSEIVFKAMGRAINKTVTIVELIK 656 KGS EIVFKAMGRAINKTVTIVELIK Sbjct: 43 KGSDEIVFKAMGRAINKTVTIVELIK 68 Score = 29.3 bits (64), Expect(2) = 9e-06 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -2 Query: 654 TRHVSLITITLSKKELD 604 TR VS++TITLSK ELD Sbjct: 102 TRKVSMVTITLSKNELD 118