BLASTX nr result
ID: Chrysanthemum22_contig00029023
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00029023 (397 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023745091.1| LRR receptor-like serine/threonine-protein k... 57 1e-06 >ref|XP_023745091.1| LRR receptor-like serine/threonine-protein kinase FLS2 [Lactuca sativa] Length = 1220 Score = 57.0 bits (136), Expect = 1e-06 Identities = 28/43 (65%), Positives = 31/43 (72%), Gaps = 1/43 (2%) Frame = +1 Query: 28 LNQGTQLQSYT-SSIYADNEGLCGAALPKNCSNHEPIATTSNK 153 + G QLQ++T SSIYA NE LCGA LPKNCSNHE TT K Sbjct: 1098 IRTGNQLQTFTDSSIYAGNEDLCGAPLPKNCSNHEDSTTTIKK 1140