BLASTX nr result
ID: Chrysanthemum22_contig00028844
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00028844 (547 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023732277.1| disease resistance protein At4g27190-like [L... 59 8e-07 >ref|XP_023732277.1| disease resistance protein At4g27190-like [Lactuca sativa] gb|PLY75045.1| hypothetical protein LSAT_2X30460 [Lactuca sativa] Length = 970 Score = 58.9 bits (141), Expect = 8e-07 Identities = 29/56 (51%), Positives = 36/56 (64%) Frame = +2 Query: 5 LESFSSGNFGIKYPALVKVSISGCSSMRLWGNGVHETPELKFVDDVPENRICFIND 172 LESF SG+ IKYP+L + + GC SM WG+GVH P +KF D + R C IND Sbjct: 902 LESFYSGHSTIKYPSLKFIKVEGCVSMTRWGHGVHVIPNIKFHD---QGRDCSIND 954