BLASTX nr result
ID: Chrysanthemum22_contig00028600
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00028600 (786 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVI02045.1| Phosphofructokinase [Cynara cardunculus var. scol... 59 4e-06 >gb|KVI02045.1| Phosphofructokinase [Cynara cardunculus var. scolymus] Length = 489 Score = 58.5 bits (140), Expect = 4e-06 Identities = 32/42 (76%), Positives = 33/42 (78%) Frame = -3 Query: 127 LLGQPSDSVKA*VSLLEASLKIGGVLSRGQAPSGHNVISGIF 2 L GQPS S+KA SL E SLKIG VLS GQAP GHNVISGIF Sbjct: 63 LFGQPSASLKAGGSLPEQSLKIGVVLSGGQAPGGHNVISGIF 104