BLASTX nr result
ID: Chrysanthemum22_contig00028322
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00028322 (508 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KRH15772.1| hypothetical protein GLYMA_14G110000 [Glycine max] 52 8e-06 >gb|KRH15772.1| hypothetical protein GLYMA_14G110000 [Glycine max] Length = 102 Score = 52.4 bits (124), Expect = 8e-06 Identities = 26/45 (57%), Positives = 32/45 (71%), Gaps = 1/45 (2%) Frame = +1 Query: 337 LQMGL*GKDERFFFTGCYLRT-SGGSGHPRLLPKEYLLIIFYEVI 468 LQ G+ + F TGCYLRT +GGSGH RLLP EYL+I+ EV+ Sbjct: 36 LQNGILKRGREIFLTGCYLRTPTGGSGHSRLLPTEYLVILLDEVM 80