BLASTX nr result
ID: Chrysanthemum22_contig00028244
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00028244 (374 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023757224.1| geranylgeranyl transferase type-1 subunit be... 86 3e-17 ref|XP_022006302.1| geranylgeranyl transferase type-1 subunit be... 84 1e-16 gb|KVI09799.1| Prenyltransferase/squalene oxidase, partial [Cyna... 82 1e-15 ref|XP_008233608.1| PREDICTED: geranylgeranyl transferase type-1... 79 9e-15 ref|XP_014621567.1| PREDICTED: geranylgeranyl transferase type-1... 78 1e-14 ref|XP_002532295.1| PREDICTED: geranylgeranyl transferase type-1... 78 2e-14 ref|XP_021683332.1| geranylgeranyl transferase type-1 subunit be... 74 2e-14 ref|XP_003518650.1| PREDICTED: geranylgeranyl transferase type-1... 78 2e-14 ref|XP_015876940.1| PREDICTED: geranylgeranyl transferase type-1... 77 3e-14 ref|XP_018810692.1| PREDICTED: geranylgeranyl transferase type-1... 77 3e-14 ref|XP_021626550.1| geranylgeranyl transferase type-1 subunit be... 77 4e-14 ref|XP_021813917.1| geranylgeranyl transferase type-1 subunit be... 77 4e-14 ref|XP_021813916.1| geranylgeranyl transferase type-1 subunit be... 77 4e-14 ref|XP_004307531.1| PREDICTED: geranylgeranyl transferase type-1... 77 6e-14 ref|XP_008370721.1| PREDICTED: geranylgeranyl transferase type-1... 77 6e-14 ref|XP_017188448.1| PREDICTED: geranylgeranyl transferase type-1... 77 6e-14 ref|XP_021910432.1| geranylgeranyl transferase type-1 subunit be... 77 8e-14 ref|XP_024176954.1| geranylgeranyl transferase type-1 subunit be... 76 1e-13 ref|XP_012089421.1| geranylgeranyl transferase type-1 subunit be... 76 1e-13 ref|XP_022635809.1| geranylgeranyl transferase type-1 subunit be... 75 1e-13 >ref|XP_023757224.1| geranylgeranyl transferase type-1 subunit beta [Lactuca sativa] gb|PLY90366.1| hypothetical protein LSAT_2X119720 [Lactuca sativa] Length = 357 Score = 85.9 bits (211), Expect = 3e-17 Identities = 39/42 (92%), Positives = 40/42 (95%) Frame = +1 Query: 1 SKYGGFSKFPGQYPDLYHSYYGFTAFSMLQETGLNSLDVELG 126 SKYGGFSKFPGQ+PDLYHSYYGFTAFSMLQET LNSL VELG Sbjct: 312 SKYGGFSKFPGQFPDLYHSYYGFTAFSMLQETDLNSLSVELG 353 >ref|XP_022006302.1| geranylgeranyl transferase type-1 subunit beta [Helianthus annuus] gb|OTF99578.1| putative prenyltransferase family protein [Helianthus annuus] Length = 360 Score = 84.0 bits (206), Expect = 1e-16 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +1 Query: 1 SKYGGFSKFPGQYPDLYHSYYGFTAFSMLQETGLNSLDVELG 126 SKYGGFSKFP Q PDLYHSYYGFTAFSMLQETGLNSL++ELG Sbjct: 310 SKYGGFSKFPRQLPDLYHSYYGFTAFSMLQETGLNSLNIELG 351 >gb|KVI09799.1| Prenyltransferase/squalene oxidase, partial [Cynara cardunculus var. scolymus] Length = 392 Score = 81.6 bits (200), Expect = 1e-15 Identities = 37/42 (88%), Positives = 39/42 (92%) Frame = +1 Query: 1 SKYGGFSKFPGQYPDLYHSYYGFTAFSMLQETGLNSLDVELG 126 S+YGGFSKFPGQ PD YHSYYGFTAFSMLQETGLNS +VELG Sbjct: 345 SEYGGFSKFPGQLPDPYHSYYGFTAFSMLQETGLNSFNVELG 386 >ref|XP_008233608.1| PREDICTED: geranylgeranyl transferase type-1 subunit beta [Prunus mume] Length = 349 Score = 79.0 bits (193), Expect = 9e-15 Identities = 36/42 (85%), Positives = 38/42 (90%) Frame = +1 Query: 1 SKYGGFSKFPGQYPDLYHSYYGFTAFSMLQETGLNSLDVELG 126 SKYGGFSKFPGQ PDLYHSYYG TAFS+L+E GLNSL VELG Sbjct: 299 SKYGGFSKFPGQLPDLYHSYYGLTAFSLLEEPGLNSLCVELG 340 >ref|XP_014621567.1| PREDICTED: geranylgeranyl transferase type-1 subunit beta-like isoform X2 [Glycine max] Length = 295 Score = 77.8 bits (190), Expect = 1e-14 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = +1 Query: 4 KYGGFSKFPGQYPDLYHSYYGFTAFSMLQETGLNSLDVELG 126 KYGGFSKFPG+YPDLYHSYYGFTAFS+L+E+GL SL ELG Sbjct: 246 KYGGFSKFPGEYPDLYHSYYGFTAFSLLEESGLKSLFSELG 286 >ref|XP_002532295.1| PREDICTED: geranylgeranyl transferase type-1 subunit beta [Ricinus communis] gb|EEF30079.1| geranylgeranyl transferase type I beta subunit, putative [Ricinus communis] Length = 370 Score = 78.2 bits (191), Expect = 2e-14 Identities = 34/42 (80%), Positives = 39/42 (92%) Frame = +1 Query: 1 SKYGGFSKFPGQYPDLYHSYYGFTAFSMLQETGLNSLDVELG 126 SKYGGFSKFPG+ PD+YHSYYG+TAFS+L+E GLNSL VELG Sbjct: 320 SKYGGFSKFPGELPDIYHSYYGYTAFSLLEEPGLNSLCVELG 361 >ref|XP_021683332.1| geranylgeranyl transferase type-1 subunit beta-like [Hevea brasiliensis] ref|XP_021683333.1| geranylgeranyl transferase type-1 subunit beta-like [Hevea brasiliensis] Length = 130 Score = 73.9 bits (180), Expect = 2e-14 Identities = 32/42 (76%), Positives = 36/42 (85%) Frame = +1 Query: 1 SKYGGFSKFPGQYPDLYHSYYGFTAFSMLQETGLNSLDVELG 126 SKYGGF KFPG+ PD+YHSYYG TAFS+L+E GLNSL ELG Sbjct: 80 SKYGGFGKFPGELPDIYHSYYGCTAFSLLEEPGLNSLSFELG 121 >ref|XP_003518650.1| PREDICTED: geranylgeranyl transferase type-1 subunit beta-like isoform X1 [Glycine max] gb|KHN27225.1| Geranylgeranyl transferase type-1 subunit beta [Glycine soja] gb|KRH70481.1| hypothetical protein GLYMA_02G093000 [Glycine max] Length = 355 Score = 77.8 bits (190), Expect = 2e-14 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = +1 Query: 4 KYGGFSKFPGQYPDLYHSYYGFTAFSMLQETGLNSLDVELG 126 KYGGFSKFPG+YPDLYHSYYGFTAFS+L+E+GL SL ELG Sbjct: 306 KYGGFSKFPGEYPDLYHSYYGFTAFSLLEESGLKSLFSELG 346 >ref|XP_015876940.1| PREDICTED: geranylgeranyl transferase type-1 subunit beta [Ziziphus jujuba] Length = 359 Score = 77.4 bits (189), Expect = 3e-14 Identities = 35/42 (83%), Positives = 37/42 (88%) Frame = +1 Query: 1 SKYGGFSKFPGQYPDLYHSYYGFTAFSMLQETGLNSLDVELG 126 SKYGGFSKFPG PDLYHSYYGFTAFS+L+E GLN L VELG Sbjct: 308 SKYGGFSKFPGDLPDLYHSYYGFTAFSLLEEPGLNPLCVELG 349 >ref|XP_018810692.1| PREDICTED: geranylgeranyl transferase type-1 subunit beta [Juglans regia] Length = 360 Score = 77.4 bits (189), Expect = 3e-14 Identities = 35/42 (83%), Positives = 38/42 (90%) Frame = +1 Query: 1 SKYGGFSKFPGQYPDLYHSYYGFTAFSMLQETGLNSLDVELG 126 S+YGGFSKFPGQ PDLYHSYYGFTAFS+L E G+NSL VELG Sbjct: 310 SEYGGFSKFPGQVPDLYHSYYGFTAFSLLGELGMNSLCVELG 351 >ref|XP_021626550.1| geranylgeranyl transferase type-1 subunit beta [Manihot esculenta] gb|OAY38642.1| hypothetical protein MANES_10G031500 [Manihot esculenta] Length = 376 Score = 77.4 bits (189), Expect = 4e-14 Identities = 33/42 (78%), Positives = 38/42 (90%) Frame = +1 Query: 1 SKYGGFSKFPGQYPDLYHSYYGFTAFSMLQETGLNSLDVELG 126 SKYGGF KFPG++PDLYHSYYG+TAFS+L+E GLNSL ELG Sbjct: 326 SKYGGFGKFPGEWPDLYHSYYGYTAFSILEEPGLNSLSFELG 367 >ref|XP_021813917.1| geranylgeranyl transferase type-1 subunit beta isoform X2 [Prunus avium] Length = 341 Score = 77.0 bits (188), Expect = 4e-14 Identities = 35/42 (83%), Positives = 37/42 (88%) Frame = +1 Query: 1 SKYGGFSKFPGQYPDLYHSYYGFTAFSMLQETGLNSLDVELG 126 SKYGGFSKFPGQ PDLYHSYYG TAFS+L+E GLN L VELG Sbjct: 291 SKYGGFSKFPGQLPDLYHSYYGLTAFSLLEEPGLNPLCVELG 332 >ref|XP_021813916.1| geranylgeranyl transferase type-1 subunit beta isoform X1 [Prunus avium] Length = 349 Score = 77.0 bits (188), Expect = 4e-14 Identities = 35/42 (83%), Positives = 37/42 (88%) Frame = +1 Query: 1 SKYGGFSKFPGQYPDLYHSYYGFTAFSMLQETGLNSLDVELG 126 SKYGGFSKFPGQ PDLYHSYYG TAFS+L+E GLN L VELG Sbjct: 299 SKYGGFSKFPGQLPDLYHSYYGLTAFSLLEEPGLNPLCVELG 340 >ref|XP_004307531.1| PREDICTED: geranylgeranyl transferase type-1 subunit beta [Fragaria vesca subsp. vesca] Length = 348 Score = 76.6 bits (187), Expect = 6e-14 Identities = 34/42 (80%), Positives = 39/42 (92%) Frame = +1 Query: 1 SKYGGFSKFPGQYPDLYHSYYGFTAFSMLQETGLNSLDVELG 126 S+YGGFSKFPG+ PDLYHSYYGFTAFS+L+E GL+SL VELG Sbjct: 298 SEYGGFSKFPGELPDLYHSYYGFTAFSLLEEPGLSSLCVELG 339 >ref|XP_008370721.1| PREDICTED: geranylgeranyl transferase type-1 subunit beta-like isoform X2 [Malus domestica] Length = 349 Score = 76.6 bits (187), Expect = 6e-14 Identities = 34/42 (80%), Positives = 37/42 (88%) Frame = +1 Query: 1 SKYGGFSKFPGQYPDLYHSYYGFTAFSMLQETGLNSLDVELG 126 S+YGGFSKFPG YPDLYHSYYGFTAFS+L+E GL L VELG Sbjct: 299 SEYGGFSKFPGDYPDLYHSYYGFTAFSLLEEPGLKPLCVELG 340 >ref|XP_017188448.1| PREDICTED: geranylgeranyl transferase type-1 subunit beta-like isoform X1 [Malus domestica] Length = 358 Score = 76.6 bits (187), Expect = 6e-14 Identities = 34/42 (80%), Positives = 37/42 (88%) Frame = +1 Query: 1 SKYGGFSKFPGQYPDLYHSYYGFTAFSMLQETGLNSLDVELG 126 S+YGGFSKFPG YPDLYHSYYGFTAFS+L+E GL L VELG Sbjct: 308 SEYGGFSKFPGDYPDLYHSYYGFTAFSLLEEPGLKPLCVELG 349 >ref|XP_021910432.1| geranylgeranyl transferase type-1 subunit beta [Carica papaya] Length = 402 Score = 76.6 bits (187), Expect = 8e-14 Identities = 34/42 (80%), Positives = 37/42 (88%) Frame = +1 Query: 1 SKYGGFSKFPGQYPDLYHSYYGFTAFSMLQETGLNSLDVELG 126 SKYGGFSKFPG+ PDLYHSYYGFTAFS+L+E GLN L ELG Sbjct: 352 SKYGGFSKFPGELPDLYHSYYGFTAFSLLEEPGLNPLCAELG 393 >ref|XP_024176954.1| geranylgeranyl transferase type-1 subunit beta isoform X1 [Rosa chinensis] gb|PRQ59103.1| putative protein geranylgeranyltransferase type I [Rosa chinensis] Length = 348 Score = 75.9 bits (185), Expect = 1e-13 Identities = 34/42 (80%), Positives = 37/42 (88%) Frame = +1 Query: 1 SKYGGFSKFPGQYPDLYHSYYGFTAFSMLQETGLNSLDVELG 126 S+YGGFSKFPG PDLYHSYYGFTAFS+L+E GLN L VELG Sbjct: 298 SQYGGFSKFPGDLPDLYHSYYGFTAFSLLEEPGLNPLCVELG 339 >ref|XP_012089421.1| geranylgeranyl transferase type-1 subunit beta [Jatropha curcas] gb|KDP44982.1| hypothetical protein JCGZ_01482 [Jatropha curcas] Length = 370 Score = 75.9 bits (185), Expect = 1e-13 Identities = 33/42 (78%), Positives = 38/42 (90%) Frame = +1 Query: 1 SKYGGFSKFPGQYPDLYHSYYGFTAFSMLQETGLNSLDVELG 126 SKYGGFSKFPG+ PD+YHS+YG TAFS+L+E GLNSL VELG Sbjct: 320 SKYGGFSKFPGELPDIYHSFYGCTAFSLLEEPGLNSLSVELG 361 >ref|XP_022635809.1| geranylgeranyl transferase type-1 subunit beta isoform X2 [Vigna radiata var. radiata] Length = 289 Score = 75.1 bits (183), Expect = 1e-13 Identities = 32/41 (78%), Positives = 38/41 (92%) Frame = +1 Query: 4 KYGGFSKFPGQYPDLYHSYYGFTAFSMLQETGLNSLDVELG 126 KYGGFSKFPG+YPDLYHS+YGFTAFS+L+E+GL SL +LG Sbjct: 240 KYGGFSKFPGEYPDLYHSFYGFTAFSLLEESGLKSLCSQLG 280