BLASTX nr result
ID: Chrysanthemum22_contig00028154
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00028154 (376 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVH90150.1| Elongated TPR repeat-containing domain-containing... 67 2e-10 ref|XP_023755328.1| hsp70-Hsp90 organizing protein 2 [Lactuca sa... 64 2e-09 ref|XP_022029610.1| hsp70-Hsp90 organizing protein 2-like [Helia... 64 2e-09 ref|XP_024169602.1| hsp70-Hsp90 organizing protein 3-like [Rosa ... 63 7e-09 ref|XP_010539811.1| PREDICTED: hsp70-Hsp90 organizing protein 3 ... 62 1e-08 ref|XP_019093490.1| PREDICTED: hsp70-Hsp90 organizing protein 2 ... 62 2e-08 ref|XP_010418273.1| PREDICTED: hsp70-Hsp90 organizing protein 2 ... 62 2e-08 ref|XP_010430348.1| PREDICTED: hsp70-Hsp90 organizing protein 2-... 62 2e-08 ref|XP_012087126.1| hsp70-Hsp90 organizing protein 3 [Jatropha c... 62 2e-08 gb|KZV40986.1| hsp70-Hsp90 organizing protein 2 [Dorcoceras hygr... 62 2e-08 ref|XP_004298670.1| PREDICTED: hsp70-Hsp90 organizing protein 3 ... 62 2e-08 gb|PIN25382.1| Molecular co-chaperone STI1 [Handroanthus impetig... 61 2e-08 ref|XP_008369530.1| PREDICTED: hsp70-Hsp90 organizing protein 3 ... 61 2e-08 ref|XP_010676185.1| PREDICTED: hsp70-Hsp90 organizing protein 3 ... 61 2e-08 ref|XP_009362109.1| PREDICTED: hsp70-Hsp90 organizing protein 3-... 61 2e-08 ref|XP_009350542.1| PREDICTED: hsp70-Hsp90 organizing protein 2-... 61 3e-08 gb|KHN34959.1| Heat shock protein STI [Glycine soja] 61 3e-08 gb|KRH77401.1| hypothetical protein GLYMA_01G211200 [Glycine max] 61 3e-08 gb|KHN42711.1| Heat shock protein STI [Glycine soja] 61 3e-08 ref|XP_003538668.1| PREDICTED: hsp70-Hsp90 organizing protein 3 ... 61 3e-08 >gb|KVH90150.1| Elongated TPR repeat-containing domain-containing protein [Cynara cardunculus var. scolymus] Length = 453 Score = 67.0 bits (162), Expect = 2e-10 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = -1 Query: 376 MMQDLQRNPSNLNLYLKDQRVMQALSVLLNVKIQ 275 MMQDLQRNPSNLNLYLKDQRVMQALSVLLN+K+Q Sbjct: 164 MMQDLQRNPSNLNLYLKDQRVMQALSVLLNIKMQ 197 >ref|XP_023755328.1| hsp70-Hsp90 organizing protein 2 [Lactuca sativa] gb|PLY99049.1| hypothetical protein LSAT_6X90720 [Lactuca sativa] Length = 583 Score = 64.3 bits (155), Expect = 2e-09 Identities = 30/34 (88%), Positives = 34/34 (100%) Frame = -1 Query: 376 MMQDLQRNPSNLNLYLKDQRVMQALSVLLNVKIQ 275 MM+DLQ+NPSNLNLYLKDQRVMQALSVLLN+K+Q Sbjct: 164 MMKDLQKNPSNLNLYLKDQRVMQALSVLLNIKMQ 197 >ref|XP_022029610.1| hsp70-Hsp90 organizing protein 2-like [Helianthus annuus] gb|OTG32554.1| putative hsp70-Hsp90 organizing protein [Helianthus annuus] Length = 590 Score = 64.3 bits (155), Expect = 2e-09 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = -1 Query: 376 MMQDLQRNPSNLNLYLKDQRVMQALSVLLNVKIQ 275 MM+DLQRNPSNLNLYL+DQRVMQALSVLLNVK+Q Sbjct: 169 MMKDLQRNPSNLNLYLQDQRVMQALSVLLNVKMQ 202 >ref|XP_024169602.1| hsp70-Hsp90 organizing protein 3-like [Rosa chinensis] gb|PRQ18095.1| putative 43kDa postsynaptic protein [Rosa chinensis] Length = 577 Score = 62.8 bits (151), Expect = 7e-09 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = -1 Query: 376 MMQDLQRNPSNLNLYLKDQRVMQALSVLLNVKIQ 275 MMQ++Q+NPSNLNLYLKDQRVMQAL VLLNVK+Q Sbjct: 163 MMQEIQKNPSNLNLYLKDQRVMQALGVLLNVKLQ 196 >ref|XP_010539811.1| PREDICTED: hsp70-Hsp90 organizing protein 3 [Tarenaya hassleriana] Length = 570 Score = 62.0 bits (149), Expect = 1e-08 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -1 Query: 376 MMQDLQRNPSNLNLYLKDQRVMQALSVLLNVKIQ 275 MMQD+Q+NPSNLNLYLKDQRVMQAL VLLNVK + Sbjct: 160 MMQDIQKNPSNLNLYLKDQRVMQALGVLLNVKFK 193 >ref|XP_019093490.1| PREDICTED: hsp70-Hsp90 organizing protein 2 [Camelina sativa] Length = 574 Score = 61.6 bits (148), Expect = 2e-08 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = -1 Query: 376 MMQDLQRNPSNLNLYLKDQRVMQALSVLLNVKIQ 275 MMQ++QRNPSNLNLYLKDQRVMQAL VLLNV+I+ Sbjct: 159 MMQEIQRNPSNLNLYLKDQRVMQALGVLLNVQIR 192 >ref|XP_010418273.1| PREDICTED: hsp70-Hsp90 organizing protein 2 [Camelina sativa] Length = 575 Score = 61.6 bits (148), Expect = 2e-08 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = -1 Query: 376 MMQDLQRNPSNLNLYLKDQRVMQALSVLLNVKIQ 275 MMQ++QRNPSNLNLYLKDQRVMQAL VLLNV+I+ Sbjct: 160 MMQEIQRNPSNLNLYLKDQRVMQALGVLLNVQIR 193 >ref|XP_010430348.1| PREDICTED: hsp70-Hsp90 organizing protein 2-like [Camelina sativa] Length = 576 Score = 61.6 bits (148), Expect = 2e-08 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = -1 Query: 376 MMQDLQRNPSNLNLYLKDQRVMQALSVLLNVKIQ 275 MMQ++QRNPSNLNLYLKDQRVMQAL VLLNV+I+ Sbjct: 160 MMQEIQRNPSNLNLYLKDQRVMQALGVLLNVQIR 193 >ref|XP_012087126.1| hsp70-Hsp90 organizing protein 3 [Jatropha curcas] gb|KDP25621.1| hypothetical protein JCGZ_20777 [Jatropha curcas] Length = 577 Score = 61.6 bits (148), Expect = 2e-08 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -1 Query: 376 MMQDLQRNPSNLNLYLKDQRVMQALSVLLNVKIQ 275 MMQ++QRNPSNLNLYLKDQRVMQAL VLLNVK + Sbjct: 160 MMQEIQRNPSNLNLYLKDQRVMQALGVLLNVKFR 193 >gb|KZV40986.1| hsp70-Hsp90 organizing protein 2 [Dorcoceras hygrometricum] Length = 578 Score = 61.6 bits (148), Expect = 2e-08 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = -1 Query: 376 MMQDLQRNPSNLNLYLKDQRVMQALSVLLNVKIQ 275 MMQDLQ+NPSNLNLYLKDQRVMQAL LLN+K Q Sbjct: 162 MMQDLQKNPSNLNLYLKDQRVMQALGALLNLKFQ 195 >ref|XP_004298670.1| PREDICTED: hsp70-Hsp90 organizing protein 3 [Fragaria vesca subsp. vesca] Length = 586 Score = 61.6 bits (148), Expect = 2e-08 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = -1 Query: 376 MMQDLQRNPSNLNLYLKDQRVMQALSVLLNVKIQ 275 MMQ++Q+NP+NLNLYLKDQRVMQAL VLLNVK+Q Sbjct: 165 MMQEIQKNPTNLNLYLKDQRVMQALGVLLNVKLQ 198 >gb|PIN25382.1| Molecular co-chaperone STI1 [Handroanthus impetiginosus] Length = 576 Score = 61.2 bits (147), Expect = 2e-08 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -1 Query: 376 MMQDLQRNPSNLNLYLKDQRVMQALSVLLNVKIQ 275 MMQD+Q+NP+NLNLYLKDQRVMQAL VLLN+K Q Sbjct: 161 MMQDIQKNPNNLNLYLKDQRVMQALGVLLNLKFQ 194 >ref|XP_008369530.1| PREDICTED: hsp70-Hsp90 organizing protein 3 [Malus domestica] Length = 578 Score = 61.2 bits (147), Expect = 2e-08 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = -1 Query: 376 MMQDLQRNPSNLNLYLKDQRVMQALSVLLNVKIQ 275 MMQ++Q+NPSNLNLYLKDQRVMQAL VLLNVK++ Sbjct: 161 MMQEIQKNPSNLNLYLKDQRVMQALGVLLNVKLR 194 >ref|XP_010676185.1| PREDICTED: hsp70-Hsp90 organizing protein 3 [Beta vulgaris subsp. vulgaris] gb|KMT12557.1| hypothetical protein BVRB_5g098030 [Beta vulgaris subsp. vulgaris] Length = 580 Score = 61.2 bits (147), Expect = 2e-08 Identities = 27/34 (79%), Positives = 33/34 (97%) Frame = -1 Query: 376 MMQDLQRNPSNLNLYLKDQRVMQALSVLLNVKIQ 275 MMQD+Q+NP+NLNLYLKDQRVMQAL VLLN+K++ Sbjct: 160 MMQDIQKNPNNLNLYLKDQRVMQALGVLLNIKLR 193 >ref|XP_009362109.1| PREDICTED: hsp70-Hsp90 organizing protein 3-like [Pyrus x bretschneideri] Length = 580 Score = 61.2 bits (147), Expect = 2e-08 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = -1 Query: 376 MMQDLQRNPSNLNLYLKDQRVMQALSVLLNVKIQ 275 MMQ++Q+NPSNLNLYLKDQRVMQAL VLLNVK++ Sbjct: 161 MMQEIQKNPSNLNLYLKDQRVMQALGVLLNVKLR 194 >ref|XP_009350542.1| PREDICTED: hsp70-Hsp90 organizing protein 2-like [Pyrus x bretschneideri] Length = 311 Score = 60.8 bits (146), Expect = 3e-08 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -1 Query: 376 MMQDLQRNPSNLNLYLKDQRVMQALSVLLNVKI 278 MMQ++Q+NPSNLNLYLKDQRVMQAL VLLNVK+ Sbjct: 161 MMQEIQKNPSNLNLYLKDQRVMQALGVLLNVKL 193 >gb|KHN34959.1| Heat shock protein STI [Glycine soja] Length = 537 Score = 60.8 bits (146), Expect = 3e-08 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = -1 Query: 376 MMQDLQRNPSNLNLYLKDQRVMQALSVLLNVKIQ 275 MMQD+QR+P+NLNL+LKDQR+MQAL VLLNVKIQ Sbjct: 116 MMQDIQRDPNNLNLHLKDQRIMQALGVLLNVKIQ 149 >gb|KRH77401.1| hypothetical protein GLYMA_01G211200 [Glycine max] Length = 554 Score = 60.8 bits (146), Expect = 3e-08 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = -1 Query: 376 MMQDLQRNPSNLNLYLKDQRVMQALSVLLNVKIQ 275 MMQD+QR+P+NLNL+LKDQR+MQAL VLLNVKIQ Sbjct: 162 MMQDIQRDPNNLNLHLKDQRIMQALGVLLNVKIQ 195 >gb|KHN42711.1| Heat shock protein STI [Glycine soja] Length = 585 Score = 60.8 bits (146), Expect = 3e-08 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = -1 Query: 376 MMQDLQRNPSNLNLYLKDQRVMQALSVLLNVKIQ 275 MMQD+QR+P+NLNL+LKDQR+MQAL VLLNVKIQ Sbjct: 162 MMQDIQRDPNNLNLHLKDQRIMQALGVLLNVKIQ 195 >ref|XP_003538668.1| PREDICTED: hsp70-Hsp90 organizing protein 3 [Glycine max] gb|KRH28032.1| hypothetical protein GLYMA_11G030500 [Glycine max] gb|KRH28033.1| hypothetical protein GLYMA_11G030500 [Glycine max] Length = 585 Score = 60.8 bits (146), Expect = 3e-08 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = -1 Query: 376 MMQDLQRNPSNLNLYLKDQRVMQALSVLLNVKIQ 275 MMQD+QR+P+NLNL+LKDQR+MQAL VLLNVKIQ Sbjct: 162 MMQDIQRDPNNLNLHLKDQRIMQALGVLLNVKIQ 195