BLASTX nr result
ID: Chrysanthemum22_contig00028133
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00028133 (560 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023752642.1| uncharacterized protein LOC111901007 [Lactuc... 57 3e-06 >ref|XP_023752642.1| uncharacterized protein LOC111901007 [Lactuca sativa] gb|PLY93926.1| hypothetical protein LSAT_1X127421 [Lactuca sativa] Length = 311 Score = 57.0 bits (136), Expect = 3e-06 Identities = 35/111 (31%), Positives = 58/111 (52%), Gaps = 4/111 (3%) Frame = -3 Query: 399 IIYLSFLYHSTITGELQLSSTPASHYYLNPNVPETRQILDVYNELLGPAPLLAIQPAPVQ 220 I+ ++ + + G LQL++TPAS+ Y+NP +PE + + E P+L I+ + Sbjct: 27 IVAITSMKVTQYLGNLQLTATPASYIYINPTIPEAAAMAAEFVERHNQNPVLKIKYQKSK 86 Query: 219 NLEGGELGNRVSLKTLLGTNPEIQQGARFTVEVRLARIDTTN----RQCHE 79 +++ + NR L LL NP GA+FT + L ID + + CHE Sbjct: 87 DVQVEKKRNRFPLVDLLSQNP--NAGAQFTCKASLVSIDASKGWFYKACHE 135