BLASTX nr result
ID: Chrysanthemum22_contig00028070
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00028070 (427 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022023541.1| TMV resistance protein N-like [Helianthus an... 66 8e-10 ref|XP_022023535.1| disease resistance protein RML1A-like [Helia... 61 4e-08 gb|OTG34882.1| putative toll/interleukin-1 receptor (TIR) domain... 61 4e-08 ref|XP_021981379.1| uncharacterized protein LOC110877535 [Helian... 59 2e-07 ref|XP_021981140.1| disease resistance protein RML1A-like [Helia... 58 5e-07 ref|XP_021978713.1| uncharacterized protein LOC110874158 [Helian... 57 6e-07 ref|XP_021979269.1| uncharacterized protein LOC110875381 [Helian... 57 7e-07 ref|XP_021978714.1| uncharacterized protein LOC110874159 [Helian... 57 8e-07 ref|XP_021979359.1| disease resistance protein RPP5-like [Helian... 57 8e-07 ref|XP_021981101.1| TMV resistance protein N-like [Helianthus an... 57 9e-07 >ref|XP_022023541.1| TMV resistance protein N-like [Helianthus annuus] gb|OTG34879.1| putative toll/interleukin-1 receptor (TIR) domain-containing protein [Helianthus annuus] Length = 1216 Score = 66.2 bits (160), Expect = 8e-10 Identities = 28/37 (75%), Positives = 30/37 (81%) Frame = +1 Query: 145 EAYLGKMKWIKSYEDHKVDLVGDVITKGRIWKFNCCY 255 EAYLGKMKWIK Y+DHKVDLVGD +TKGRIW Y Sbjct: 855 EAYLGKMKWIKEYQDHKVDLVGDEVTKGRIWHMQMLY 891 >ref|XP_022023535.1| disease resistance protein RML1A-like [Helianthus annuus] Length = 1219 Score = 61.2 bits (147), Expect = 4e-08 Identities = 26/37 (70%), Positives = 28/37 (75%) Frame = +1 Query: 145 EAYLGKMKWIKSYEDHKVDLVGDVITKGRIWKFNCCY 255 E YLGKMKWIK Y+D KVDLVGD +TKGRIW Y Sbjct: 859 EVYLGKMKWIKEYQDDKVDLVGDEVTKGRIWHMQILY 895 >gb|OTG34882.1| putative toll/interleukin-1 receptor (TIR) domain-containing protein [Helianthus annuus] Length = 1232 Score = 61.2 bits (147), Expect = 4e-08 Identities = 26/37 (70%), Positives = 28/37 (75%) Frame = +1 Query: 145 EAYLGKMKWIKSYEDHKVDLVGDVITKGRIWKFNCCY 255 E YLGKMKWIK Y+D KVDLVGD +TKGRIW Y Sbjct: 872 EVYLGKMKWIKEYQDDKVDLVGDEVTKGRIWHMQILY 908 >ref|XP_021981379.1| uncharacterized protein LOC110877535 [Helianthus annuus] gb|OTG14048.1| putative heavy metal-associated domain, HMA, Leucine-rich repeat domain, L domain-like protein [Helianthus annuus] Length = 469 Score = 59.3 bits (142), Expect = 2e-07 Identities = 26/37 (70%), Positives = 28/37 (75%) Frame = +1 Query: 145 EAYLGKMKWIKSYEDHKVDLVGDVITKGRIWKFNCCY 255 EA LG MKWIK+YEDHKVDLVGD +TKGR W Y Sbjct: 134 EADLGHMKWIKAYEDHKVDLVGDEVTKGRDWNIQMLY 170 >ref|XP_021981140.1| disease resistance protein RML1A-like [Helianthus annuus] gb|OTG13758.1| putative toll/interleukin-1 receptor (TIR) domain-containing protein [Helianthus annuus] Length = 1181 Score = 58.2 bits (139), Expect = 5e-07 Identities = 25/42 (59%), Positives = 31/42 (73%) Frame = +1 Query: 130 MLRFYEAYLGKMKWIKSYEDHKVDLVGDVITKGRIWKFNCCY 255 +++ A LG M+W+K+YEDHKVDLVGD ITKGRIW Y Sbjct: 847 VVKMEAADLGDMQWVKAYEDHKVDLVGDEITKGRIWNTQMLY 888 >ref|XP_021978713.1| uncharacterized protein LOC110874158 [Helianthus annuus] ref|XP_021978725.1| uncharacterized protein LOC110874204 [Helianthus annuus] Length = 274 Score = 57.4 bits (137), Expect = 6e-07 Identities = 25/37 (67%), Positives = 29/37 (78%) Frame = +1 Query: 145 EAYLGKMKWIKSYEDHKVDLVGDVITKGRIWKFNCCY 255 EA LG M+WIK+YEDHKV+LVGD ITKG+IW Y Sbjct: 134 EAELGHMQWIKAYEDHKVELVGDEITKGKIWHTQVLY 170 >ref|XP_021979269.1| uncharacterized protein LOC110875381 [Helianthus annuus] Length = 298 Score = 57.4 bits (137), Expect = 7e-07 Identities = 25/37 (67%), Positives = 29/37 (78%) Frame = +1 Query: 145 EAYLGKMKWIKSYEDHKVDLVGDVITKGRIWKFNCCY 255 EA LG M+WIK+YEDHKV+LVGD ITKG+IW Y Sbjct: 134 EAELGHMQWIKAYEDHKVELVGDEITKGKIWHTQVLY 170 >ref|XP_021978714.1| uncharacterized protein LOC110874159 [Helianthus annuus] ref|XP_021978724.1| uncharacterized protein LOC110874202 [Helianthus annuus] ref|XP_021978727.1| uncharacterized protein LOC110874207 [Helianthus annuus] Length = 371 Score = 57.4 bits (137), Expect = 8e-07 Identities = 25/37 (67%), Positives = 29/37 (78%) Frame = +1 Query: 145 EAYLGKMKWIKSYEDHKVDLVGDVITKGRIWKFNCCY 255 EA LG M+WIK+YEDHKV+LVGD ITKG+IW Y Sbjct: 134 EAELGHMQWIKAYEDHKVELVGDEITKGKIWHTQVLY 170 >ref|XP_021979359.1| disease resistance protein RPP5-like [Helianthus annuus] Length = 409 Score = 57.4 bits (137), Expect = 8e-07 Identities = 25/37 (67%), Positives = 29/37 (78%) Frame = +1 Query: 145 EAYLGKMKWIKSYEDHKVDLVGDVITKGRIWKFNCCY 255 EA LG M+WIK+YEDHKV+LVGD ITKG+IW Y Sbjct: 269 EAELGHMQWIKAYEDHKVELVGDEITKGKIWHTQVLY 305 >ref|XP_021981101.1| TMV resistance protein N-like [Helianthus annuus] gb|OTG13704.1| putative NB-ARC [Helianthus annuus] Length = 1037 Score = 57.4 bits (137), Expect = 9e-07 Identities = 26/37 (70%), Positives = 28/37 (75%) Frame = +1 Query: 145 EAYLGKMKWIKSYEDHKVDLVGDVITKGRIWKFNCCY 255 E LG M+WIK+YEDHKVDLVGD ITKGRIW Y Sbjct: 705 EEDLGHMQWIKAYEDHKVDLVGDDITKGRIWHTQMLY 741