BLASTX nr result
ID: Chrysanthemum22_contig00027806
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00027806 (1387 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022035107.1| uncharacterized protein LOC110937003 [Helian... 55 4e-06 >ref|XP_022035107.1| uncharacterized protein LOC110937003 [Helianthus annuus] gb|OTG28678.1| putative 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein [Helianthus annuus] Length = 505 Score = 54.7 bits (130), Expect(2) = 4e-06 Identities = 35/71 (49%), Positives = 43/71 (60%), Gaps = 3/71 (4%) Frame = +1 Query: 1075 STFIGYCKDSSKRSKEAHAPCSSTKTLLPASMETD*DDPLV-VEAHQI*LAHVGICYT-- 1245 +TFIGYCKD S +SK HAPCS K LLP S+E + D LV + QI LA V I T Sbjct: 91 ATFIGYCKDFSLQSKVEHAPCSGEKKLLPESLEAEQDSLLVGDDPCQIYLAQVPIMNTEK 150 Query: 1246 MDKLYLGEAFE 1278 +++ LG E Sbjct: 151 EERVQLGVLIE 161 Score = 26.2 bits (56), Expect(2) = 4e-06 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +2 Query: 878 EHI*TSMVVNRGILRYAPVFYFDIINHESV 967 E + S V + + APVFY DI NHE V Sbjct: 57 EELAGSSTVEVMLSKSAPVFYGDIRNHERV 86