BLASTX nr result
ID: Chrysanthemum22_contig00027200
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00027200 (405 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022030314.1| replication protein A 70 kDa DNA-binding sub... 54 8e-06 >ref|XP_022030314.1| replication protein A 70 kDa DNA-binding subunit B-like [Helianthus annuus] Length = 533 Score = 54.3 bits (129), Expect = 8e-06 Identities = 27/61 (44%), Positives = 41/61 (67%) Frame = -1 Query: 369 YADKMNAFLGNRSSVGHVVLIIQFVKHNIY*GAPNVSNKYNANKENICTNIPEINNFKKT 190 YAD++ AF GN + +VV++IQF K+ + G NVSN Y + I ++IPEI +FKK+ Sbjct: 293 YADQIRAFEGNHPAEKNVVVVIQFGKYRFWGGHVNVSNLYTVTRVFINSDIPEILDFKKS 352 Query: 189 Y 187 + Sbjct: 353 F 353