BLASTX nr result
ID: Chrysanthemum22_contig00027154
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00027154 (357 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVH87800.1| C2 calcium-dependent membrane targeting [Cynara c... 59 2e-07 >gb|KVH87800.1| C2 calcium-dependent membrane targeting [Cynara cardunculus var. scolymus] Length = 536 Score = 58.5 bits (140), Expect = 2e-07 Identities = 30/44 (68%), Positives = 33/44 (75%) Frame = +2 Query: 5 KVVDYNLNPVWNHVIRLIAEDKKTQCVVLEVTLFSFLLFCIAGF 136 KVVD NLNPVWNHV++LIAEDK+TQ V EV LF LL A F Sbjct: 295 KVVDNNLNPVWNHVLQLIAEDKETQFAVFEVKLFFCLLSYRAWF 338