BLASTX nr result
ID: Chrysanthemum22_contig00027143
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00027143 (598 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_009383534.1| ribosomal protein S14 (chloroplast) [Aster a... 187 5e-58 ref|YP_009256032.1| ribosomal protein S14 (chloroplast) [Scopoli... 182 4e-56 ref|YP_009456307.1| ribosomal protein S14 (chloroplast) [Ambrosi... 174 4e-53 gb|ATQ36709.1| ribosomal protein S14 (chloroplast) [Artemisia fr... 173 1e-52 gb|ATQ36711.1| ribosomal protein S14 (chloroplast) [Artemisia he... 173 1e-52 gb|ATQ36716.1| ribosomal protein S14 (chloroplast) [Chrysanthemu... 173 1e-52 ref|YP_007624793.1| chloroplast 30S ribosomal protein S14 (chlor... 173 1e-52 ref|YP_009373914.1| ribosomal protein S14 (chloroplast) [Bacchar... 172 3e-52 gb|ATQ36708.1| ribosomal protein S14 (chloroplast) [Calendula of... 171 5e-52 gb|ATQ36715.1| ribosomal protein S14 (chloroplast) [Artemisia sc... 171 5e-52 gb|AKZ24248.1| ribosomal protein S14 (plastid) [Solidago missour... 171 5e-52 gb|PHT52839.1| 30S ribosomal protein S14, chloroplastic [Capsicu... 178 5e-52 ref|YP_588115.1| ribosomal protein S14 (chloroplast) [Helianthus... 171 1e-51 dbj|BAC77548.1| ribosomal protein S14 (chloroplast) [Nicotiana s... 170 1e-51 gb|ATQ36714.1| ribosomal protein S14 (chloroplast) [Achillea mil... 169 4e-51 gb|ATQ36717.1| ribosomal protein S14 (chloroplast) [Sonchus arve... 169 4e-51 gb|ATQ36713.1| ribosomal protein S14 (chloroplast) [Parthenium h... 169 4e-51 ref|YP_398327.1| ribosomal protein S14 [Lactuca sativa] >gi|1832... 169 4e-51 gb|AJE73897.1| ribosomal protein S14 (plastid) [Vernonia baldwin... 169 4e-51 ref|NP_783230.1| ribosomal protein S14 [Atropa belladonna] >gi|4... 169 4e-51 >ref|YP_009383534.1| ribosomal protein S14 (chloroplast) [Aster altaicus] gb|ARR27831.1| ribosomal protein S14 (chloroplast) [Aster altaicus] Length = 109 Score = 187 bits (474), Expect = 5e-58 Identities = 94/109 (86%), Positives = 95/109 (87%) Frame = -2 Query: 381 MDTNRNLTSMAKKSLIXXXXXXXXXXXKYHSIRRSLKEEISKVRSLSDKWEIYGKLQSLP 202 MDTNRNLTSMAKKSLI KYH IRRS K+EISKVRSLSDKWEIYGKLQS P Sbjct: 1 MDTNRNLTSMAKKSLIQREKKRQKLEQKYHLIRRSSKKEISKVRSLSDKWEIYGKLQSPP 60 Query: 201 RNSAPTRLHRRCFSTGRPRANYRDFGLSGHILREMVHACLLPGATRSSW 55 RNSAPTRLHRRCFSTGRPRANYRDFGLSGHILREMVHACLLPGATRSSW Sbjct: 61 RNSAPTRLHRRCFSTGRPRANYRDFGLSGHILREMVHACLLPGATRSSW 109 >ref|YP_009256032.1| ribosomal protein S14 (chloroplast) [Scopolia parviflora] gb|ANF05211.1| ribosomal protein S14 (chloroplast) [Scopolia parviflora] Length = 109 Score = 182 bits (462), Expect = 4e-56 Identities = 92/109 (84%), Positives = 93/109 (85%) Frame = -2 Query: 381 MDTNRNLTSMAKKSLIXXXXXXXXXXXKYHSIRRSLKEEISKVRSLSDKWEIYGKLQSLP 202 MDTNRN T MAKKSLI KYHSIRRS K+EISKV SLSDKWEIYGKLQSLP Sbjct: 1 MDTNRNSTIMAKKSLIQREKKRQKLEQKYHSIRRSSKKEISKVPSLSDKWEIYGKLQSLP 60 Query: 201 RNSAPTRLHRRCFSTGRPRANYRDFGLSGHILREMVHACLLPGATRSSW 55 RNSAPTRLHRRCF TGRPRANYRDFGLSGHILREMVHACLLPGATRSSW Sbjct: 61 RNSAPTRLHRRCFLTGRPRANYRDFGLSGHILREMVHACLLPGATRSSW 109 >ref|YP_009456307.1| ribosomal protein S14 (chloroplast) [Ambrosia trifida] gb|AUJ22619.1| ribosomal protein S14 (chloroplast) [Ambrosia artemisiifolia] gb|AUJ22706.1| ribosomal protein S14 (chloroplast) [Ambrosia trifida] Length = 100 Score = 174 bits (441), Expect = 4e-53 Identities = 87/100 (87%), Positives = 88/100 (88%) Frame = -2 Query: 354 MAKKSLIXXXXXXXXXXXKYHSIRRSLKEEISKVRSLSDKWEIYGKLQSLPRNSAPTRLH 175 MAKKSLI KYH IRRSLK+EISKVRSLSDKWEIYGKLQSLPRNSAPTRLH Sbjct: 1 MAKKSLIQREKKRQKLEQKYHLIRRSLKKEISKVRSLSDKWEIYGKLQSLPRNSAPTRLH 60 Query: 174 RRCFSTGRPRANYRDFGLSGHILREMVHACLLPGATRSSW 55 RRCFSTGRPRANYRDFGLSGHILREMVHACLLPGATRSSW Sbjct: 61 RRCFSTGRPRANYRDFGLSGHILREMVHACLLPGATRSSW 100 >gb|ATQ36709.1| ribosomal protein S14 (chloroplast) [Artemisia fragrans] Length = 100 Score = 173 bits (438), Expect = 1e-52 Identities = 87/100 (87%), Positives = 87/100 (87%) Frame = -2 Query: 354 MAKKSLIXXXXXXXXXXXKYHSIRRSLKEEISKVRSLSDKWEIYGKLQSLPRNSAPTRLH 175 MAKKSLI KYHSIRRS KEEISKVRSLSDKWEIYGKLQS PRNSAPTRLH Sbjct: 1 MAKKSLIQRTRQEQHFGQKYHSIRRSSKEEISKVRSLSDKWEIYGKLQSPPRNSAPTRLH 60 Query: 174 RRCFSTGRPRANYRDFGLSGHILREMVHACLLPGATRSSW 55 RRCFSTGRPRANYRDFGLSGHILREMVHACLLPGATRSSW Sbjct: 61 RRCFSTGRPRANYRDFGLSGHILREMVHACLLPGATRSSW 100 >gb|ATQ36711.1| ribosomal protein S14 (chloroplast) [Artemisia herba-alba] Length = 100 Score = 173 bits (438), Expect = 1e-52 Identities = 87/100 (87%), Positives = 87/100 (87%) Frame = -2 Query: 354 MAKKSLIXXXXXXXXXXXKYHSIRRSLKEEISKVRSLSDKWEIYGKLQSLPRNSAPTRLH 175 MAKKSLI KYHSIRRS KEEISKVRSLSDKWEIYGKLQS PRNSAPTRLH Sbjct: 1 MAKKSLIQRLKHEQHFGQKYHSIRRSSKEEISKVRSLSDKWEIYGKLQSPPRNSAPTRLH 60 Query: 174 RRCFSTGRPRANYRDFGLSGHILREMVHACLLPGATRSSW 55 RRCFSTGRPRANYRDFGLSGHILREMVHACLLPGATRSSW Sbjct: 61 RRCFSTGRPRANYRDFGLSGHILREMVHACLLPGATRSSW 100 >gb|ATQ36716.1| ribosomal protein S14 (chloroplast) [Chrysanthemum indicum] Length = 100 Score = 173 bits (438), Expect = 1e-52 Identities = 87/100 (87%), Positives = 87/100 (87%) Frame = -2 Query: 354 MAKKSLIXXXXXXXXXXXKYHSIRRSLKEEISKVRSLSDKWEIYGKLQSLPRNSAPTRLH 175 MAKKSLI KYHSIRRS KEEISKVRSLSDKWEIYGKLQS PRNSAPTRLH Sbjct: 1 MAKKSLIQRSVRREQIGQKYHSIRRSSKEEISKVRSLSDKWEIYGKLQSPPRNSAPTRLH 60 Query: 174 RRCFSTGRPRANYRDFGLSGHILREMVHACLLPGATRSSW 55 RRCFSTGRPRANYRDFGLSGHILREMVHACLLPGATRSSW Sbjct: 61 RRCFSTGRPRANYRDFGLSGHILREMVHACLLPGATRSSW 100 >ref|YP_007624793.1| chloroplast 30S ribosomal protein S14 (chloroplast) [Artemisia frigida] ref|YP_009111735.1| chloroplast 30S ribosomal protein S14 (chloroplast) [Artemisia montana] ref|YP_009272075.1| ribosomal protein S14 (chloroplast) [Artemisia argyi] ref|YP_009307750.1| ribosomal protein S14 (chloroplast) [Artemisia gmelinii] ref|YP_009307838.1| ribosomal protein S14 (chloroplast) [Artemisia capillaris] ref|YP_009365239.1| chloroplast 30S ribosomal protein S14 (plastid) [Artemisia annua] gb|AFP98819.1| chloroplast 30S ribosomal protein S14 (chloroplast) [Artemisia frigida] gb|AHJ61143.1| chloroplast 30S ribosomal protein S14 (chloroplast) [Artemisia montana] gb|AJB98626.1| ribosomal protein S14 (chloroplast) [Artemisia argyi] gb|ANS11255.1| ribosomal protein S14 (chloroplast) [Artemisia fukudo] gb|AOR82584.1| ribosomal protein S14 (chloroplast) [Artemisia gmelinii] gb|AOR82672.1| ribosomal protein S14 (chloroplast) [Artemisia capillaris] gb|ARJ60797.1| chloroplast 30S ribosomal protein S14 (plastid) [Artemisia annua] gb|ARU07808.1| ribosomal protein S14 (chloroplast) [Artemisia gmelinii] gb|ARU07896.1| ribosomal protein S14 (chloroplast) [Artemisia capillaris] gb|ATL16580.1| ribosomal protein S14 (chloroplast) [Artemisia princeps] gb|ATL16642.1| ribosomal protein S14 (chloroplast) [Artemisia argyrophylla] gb|ATL16704.1| ribosomal protein S14 (chloroplast) [Artemisia montana] gb|ATL16902.1| ribosomal protein S14 (chloroplast) [Chrysanthemum zawadskii var. latilobum] gb|ATL16964.1| ribosomal protein S14 (chloroplast) [Chrysanthemum zawadskii subsp. coreanum] gb|ATU84299.1| ribosomal protein S14 (chloroplast) [Artemisia annua] gb|AVI25907.1| ribosomal protein S14 (chloroplast) [Chrysanthemum boreale] Length = 100 Score = 173 bits (438), Expect = 1e-52 Identities = 87/100 (87%), Positives = 87/100 (87%) Frame = -2 Query: 354 MAKKSLIXXXXXXXXXXXKYHSIRRSLKEEISKVRSLSDKWEIYGKLQSLPRNSAPTRLH 175 MAKKSLI KYHSIRRS KEEISKVRSLSDKWEIYGKLQS PRNSAPTRLH Sbjct: 1 MAKKSLIQREKKRQKLEQKYHSIRRSSKEEISKVRSLSDKWEIYGKLQSPPRNSAPTRLH 60 Query: 174 RRCFSTGRPRANYRDFGLSGHILREMVHACLLPGATRSSW 55 RRCFSTGRPRANYRDFGLSGHILREMVHACLLPGATRSSW Sbjct: 61 RRCFSTGRPRANYRDFGLSGHILREMVHACLLPGATRSSW 100 >ref|YP_009373914.1| ribosomal protein S14 (chloroplast) [Baccharis genistelloides] gb|ARH03544.1| ribosomal protein S14 (chloroplast) [Baccharis genistelloides] Length = 100 Score = 172 bits (435), Expect = 3e-52 Identities = 86/100 (86%), Positives = 87/100 (87%) Frame = -2 Query: 354 MAKKSLIXXXXXXXXXXXKYHSIRRSLKEEISKVRSLSDKWEIYGKLQSLPRNSAPTRLH 175 MAKKSLI KYH IRRS K+EISKVRSLSDKWEIYGKLQSLPRNSAPTRLH Sbjct: 1 MAKKSLIQREKKRQKLEQKYHLIRRSSKKEISKVRSLSDKWEIYGKLQSLPRNSAPTRLH 60 Query: 174 RRCFSTGRPRANYRDFGLSGHILREMVHACLLPGATRSSW 55 RRCFSTGRPRANYRDFGLSGHILREMVHACLLPGATRSSW Sbjct: 61 RRCFSTGRPRANYRDFGLSGHILREMVHACLLPGATRSSW 100 >gb|ATQ36708.1| ribosomal protein S14 (chloroplast) [Calendula officinalis] gb|ATU82387.1| ribosomal protein S14 (chloroplast) [Achillea santolina] Length = 100 Score = 171 bits (434), Expect = 5e-52 Identities = 86/100 (86%), Positives = 86/100 (86%) Frame = -2 Query: 354 MAKKSLIXXXXXXXXXXXKYHSIRRSLKEEISKVRSLSDKWEIYGKLQSLPRNSAPTRLH 175 MAKKSLI KYHSIRRS KEEISKVRSLSDKWEIYGKLQS PRNSAPTRLH Sbjct: 1 MAKKSLIQRLDTEQHLGQKYHSIRRSSKEEISKVRSLSDKWEIYGKLQSPPRNSAPTRLH 60 Query: 174 RRCFSTGRPRANYRDFGLSGHILREMVHACLLPGATRSSW 55 RRCFSTGRPRANYRDFGLSGHILREMVHACLLPGATR SW Sbjct: 61 RRCFSTGRPRANYRDFGLSGHILREMVHACLLPGATRQSW 100 >gb|ATQ36715.1| ribosomal protein S14 (chloroplast) [Artemisia scoparia] Length = 100 Score = 171 bits (434), Expect = 5e-52 Identities = 86/100 (86%), Positives = 86/100 (86%) Frame = -2 Query: 354 MAKKSLIXXXXXXXXXXXKYHSIRRSLKEEISKVRSLSDKWEIYGKLQSLPRNSAPTRLH 175 MAKKSL KYHSIRRS KEEISKVRSLSDKWEIYGKLQS PRNSAPTRLH Sbjct: 1 MAKKSLFLQSNQPHQLAQKYHSIRRSSKEEISKVRSLSDKWEIYGKLQSPPRNSAPTRLH 60 Query: 174 RRCFSTGRPRANYRDFGLSGHILREMVHACLLPGATRSSW 55 RRCFSTGRPRANYRDFGLSGHILREMVHACLLPGATRSSW Sbjct: 61 RRCFSTGRPRANYRDFGLSGHILREMVHACLLPGATRSSW 100 >gb|AKZ24248.1| ribosomal protein S14 (plastid) [Solidago missouriensis] Length = 100 Score = 171 bits (434), Expect = 5e-52 Identities = 86/100 (86%), Positives = 87/100 (87%) Frame = -2 Query: 354 MAKKSLIXXXXXXXXXXXKYHSIRRSLKEEISKVRSLSDKWEIYGKLQSLPRNSAPTRLH 175 MAKKSLI KYH IRRSLK+EISKVRSLSDKWEIYGKLQS PRNSAPTRLH Sbjct: 1 MAKKSLIQREKKRQKLEQKYHLIRRSLKKEISKVRSLSDKWEIYGKLQSPPRNSAPTRLH 60 Query: 174 RRCFSTGRPRANYRDFGLSGHILREMVHACLLPGATRSSW 55 RRCFSTGRPRANYRDFGLSGHILREMVHACLLPGATRSSW Sbjct: 61 RRCFSTGRPRANYRDFGLSGHILREMVHACLLPGATRSSW 100 >gb|PHT52839.1| 30S ribosomal protein S14, chloroplastic [Capsicum baccatum] Length = 298 Score = 178 bits (451), Expect = 5e-52 Identities = 91/108 (84%), Positives = 92/108 (85%) Frame = -2 Query: 381 MDTNRNLTSMAKKSLIXXXXXXXXXXXKYHSIRRSLKEEISKVRSLSDKWEIYGKLQSLP 202 MDTNRN T MAKKSLI KYHSIRRS K+EISKV SLSDKWEIYGKLQSLP Sbjct: 1 MDTNRNSTIMAKKSLIQREKKRQKLEQKYHSIRRSSKKEISKVPSLSDKWEIYGKLQSLP 60 Query: 201 RNSAPTRLHRRCFSTGRPRANYRDFGLSGHILREMVHACLLPGATRSS 58 RNSAPTRLHRRCF TGRPRANYRDFGLSGHILREMVHACLLPGATRSS Sbjct: 61 RNSAPTRLHRRCFLTGRPRANYRDFGLSGHILREMVHACLLPGATRSS 108 >ref|YP_588115.1| ribosomal protein S14 (chloroplast) [Helianthus annuus] ref|YP_008964355.1| ribosomal protein S14 [Helianthus divaricatus] ref|YP_008964440.1| ribosomal protein S14 [Helianthus decapetalus] ref|YP_008964695.1| ribosomal protein S14 [Helianthus strumosus] ref|YP_008964780.1| ribosomal protein S14 [Helianthus maximiliani] ref|YP_008964185.1| ribosomal protein S14 [Helianthus giganteus] ref|YP_008964270.1| ribosomal protein S14 [Helianthus grosseserratus] ref|YP_008964525.1| ribosomal protein S14 [Helianthus hirsutus] ref|YP_008964610.1| ribosomal protein S14 [Helianthus tuberosus] ref|YP_009252947.1| ribosomal protein S14 (chloroplast) [Helianthus debilis] ref|YP_009255873.1| ribosomal protein S14 (chloroplast) [Helianthus argophyllus] sp|Q1KXW1.1|RR14_HELAN RecName: Full=30S ribosomal protein S14, chloroplastic gb|ABD47144.1| ribosomal protein S14 (chloroplast) [Helianthus annuus] gb|AHB14455.1| ribosomal protein S14 (plastid) [Helianthus giganteus] gb|AHB14540.1| ribosomal protein S14 (plastid) [Helianthus giganteus] gb|AHB14625.1| ribosomal protein S14 (plastid) [Helianthus giganteus] gb|AHB14710.1| ribosomal protein S14 (plastid) [Helianthus giganteus] gb|AHB14795.1| ribosomal protein S14 (plastid) [Helianthus grosseserratus] gb|AHB14880.1| ribosomal protein S14 (plastid) [Helianthus grosseserratus] gb|AHB14965.1| ribosomal protein S14 (plastid) [Helianthus divaricatus] gb|AHB15050.1| ribosomal protein S14 (plastid) [Helianthus divaricatus] gb|AHB15135.1| ribosomal protein S14 (plastid) [Helianthus divaricatus] gb|AHB15220.1| ribosomal protein S14 (plastid) [Helianthus divaricatus] gb|AHB15305.1| ribosomal protein S14 (plastid) [Helianthus decapetalus] gb|AHB15390.1| ribosomal protein S14 (plastid) [Helianthus decapetalus] gb|AHB15475.1| ribosomal protein S14 (plastid) [Helianthus decapetalus] gb|AHB15560.1| ribosomal protein S14 (plastid) [Helianthus hirsutus] gb|AHB15645.1| ribosomal protein S14 (plastid) [Helianthus hirsutus] gb|AHB15730.1| ribosomal protein S14 (plastid) [Helianthus tuberosus] gb|AHB15815.1| ribosomal protein S14 (plastid) [Helianthus tuberosus] gb|AHB15900.1| ribosomal protein S14 (plastid) [Helianthus tuberosus] gb|AHB15985.1| ribosomal protein S14 (plastid) [Helianthus divaricatus] gb|AHB16070.1| ribosomal protein S14 (plastid) [Helianthus giganteus] gb|AHB16155.1| ribosomal protein S14 (plastid) [Helianthus giganteus] gb|AHB16240.1| ribosomal protein S14 (plastid) [Helianthus grosseserratus] gb|AHB16325.1| ribosomal protein S14 (plastid) [Helianthus grosseserratus] gb|AHB16410.1| ribosomal protein S14 (plastid) [Helianthus grosseserratus] gb|AHB16495.1| ribosomal protein S14 (plastid) [Helianthus grosseserratus] gb|AHB16580.1| ribosomal protein S14 (plastid) [Helianthus decapetalus] gb|AHB16665.1| ribosomal protein S14 (plastid) [Helianthus decapetalus] gb|AHB16750.1| ribosomal protein S14 (plastid) [Helianthus decapetalus] gb|AHB16835.1| ribosomal protein S14 (plastid) [Helianthus hirsutus] gb|AHB16920.1| ribosomal protein S14 (plastid) [Helianthus hirsutus] gb|AHB17005.1| ribosomal protein S14 (plastid) [Helianthus strumosus] gb|AHB17090.1| ribosomal protein S14 (plastid) [Helianthus tuberosus] gb|AHB17175.1| ribosomal protein S14 (plastid) [Helianthus tuberosus] gb|AHB17260.1| ribosomal protein S14 (plastid) [Helianthus tuberosus] gb|AHB17345.1| ribosomal protein S14 (plastid) [Helianthus maximiliani] gb|AHB17430.1| ribosomal protein S14 (plastid) [Helianthus maximiliani] gb|AHB17515.1| ribosomal protein S14 (plastid) [Helianthus maximiliani] gb|AHB17600.1| ribosomal protein S14 (plastid) [Helianthus maximiliani] gb|AJE74277.1| ribosomal protein S14 (plastid) [Helianthus petiolaris] gb|AJE74429.1| ribosomal protein S14 (plastid) [Helianthus mollis] gb|AJE74961.1| ribosomal protein S14 (plastid) [Achillea millefolium] gb|AKZ24242.1| ribosomal protein S14 (plastid) [Helianthus pauciflorus subsp. subrhomboideus] gb|AKZ24243.1| ribosomal protein S14 (plastid) [Helianthus tuberosus] gb|AMQ33935.1| ribosomal protein S14 (chloroplast) [Helianthus petiolaris subsp. fallax] gb|AMX21469.1| ribosomal protein S14 (chloroplast) [Helianthus praecox] gb|AMX22342.1| ribosomal protein S14 (chloroplast) [Helianthus petiolaris] gb|ANA91206.1| ribosomal protein S14 (chloroplast) [Helianthus debilis] gb|ANB78992.1| ribosomal protein S14 (chloroplast) [Helianthus annuus subsp. texanus] gb|ANF03663.1| ribosomal protein S14 (chloroplast) [Helianthus argophyllus] gb|ANF03900.1| ribosomal protein S14 (plastid) [Helianthus annuus] gb|OTF84443.1| putative ribosomal protein S14 [Helianthus annuus] gb|OTF84567.1| putative ribosomal protein S14 [Helianthus annuus] gb|OTF84753.1| putative ribosomal protein S14 (plastid) [Helianthus annuus] gb|OTG07118.1| putative ribosomal protein S14 [Helianthus annuus] gb|OTG09976.1| putative ribosomal protein S14 [Helianthus annuus] gb|OTG17279.1| putative ribosomal protein S14 [Helianthus annuus] gb|OTG21158.1| putative ribosomal protein S14 [Helianthus annuus] gb|OTG25789.1| putative ribosomal protein S14 [Helianthus annuus] gb|OTG27376.1| putative ribosomal protein S14 [Helianthus annuus] gb|OTG34073.1| putative ribosomal protein S14 [Helianthus annuus] gb|AVN90069.1| ribosomal protein S14 (chloroplast) [Helianthus tuberosus] Length = 100 Score = 171 bits (432), Expect = 1e-51 Identities = 86/100 (86%), Positives = 86/100 (86%) Frame = -2 Query: 354 MAKKSLIXXXXXXXXXXXKYHSIRRSLKEEISKVRSLSDKWEIYGKLQSLPRNSAPTRLH 175 MAKKSLI KYH IRRS KEEISKVRSLSDKWEIYGKLQS PRNSAPTRLH Sbjct: 1 MAKKSLIQREKKRQKLEQKYHLIRRSSKEEISKVRSLSDKWEIYGKLQSPPRNSAPTRLH 60 Query: 174 RRCFSTGRPRANYRDFGLSGHILREMVHACLLPGATRSSW 55 RRCFSTGRPRANYRDFGLSGHILREMVHACLLPGATRSSW Sbjct: 61 RRCFSTGRPRANYRDFGLSGHILREMVHACLLPGATRSSW 100 >dbj|BAC77548.1| ribosomal protein S14 (chloroplast) [Nicotiana sylvestris] dbj|BAC77571.1| ribosomal protein S14, partial (chloroplast) [Nicotiana tomentosiformis] Length = 100 Score = 170 bits (431), Expect = 1e-51 Identities = 85/100 (85%), Positives = 87/100 (87%) Frame = -2 Query: 354 MAKKSLIXXXXXXXXXXXKYHSIRRSLKEEISKVRSLSDKWEIYGKLQSLPRNSAPTRLH 175 MA+KSLI KYHSIRRSLK+EISKV SLSDKWEIYGKLQSLPRNSAPTRLH Sbjct: 1 MARKSLIQREKKRQKLEQKYHSIRRSLKKEISKVPSLSDKWEIYGKLQSLPRNSAPTRLH 60 Query: 174 RRCFSTGRPRANYRDFGLSGHILREMVHACLLPGATRSSW 55 RRCF TGRPRANYRDFGLSGHILREMVHACLLPGATRSSW Sbjct: 61 RRCFLTGRPRANYRDFGLSGHILREMVHACLLPGATRSSW 100 >gb|ATQ36714.1| ribosomal protein S14 (chloroplast) [Achillea millefolium] Length = 100 Score = 169 bits (428), Expect = 4e-51 Identities = 85/100 (85%), Positives = 85/100 (85%) Frame = -2 Query: 354 MAKKSLIXXXXXXXXXXXKYHSIRRSLKEEISKVRSLSDKWEIYGKLQSLPRNSAPTRLH 175 MAKKSLI KYH IRRS KEEISKVRSLSDKWEIYGKLQS PRNSAPTRLH Sbjct: 1 MAKKSLIQRSRQVEHIGQKYHLIRRSSKEEISKVRSLSDKWEIYGKLQSPPRNSAPTRLH 60 Query: 174 RRCFSTGRPRANYRDFGLSGHILREMVHACLLPGATRSSW 55 RRCFSTGRPRANYRDFGLSGHILREMVHACLLPGATR SW Sbjct: 61 RRCFSTGRPRANYRDFGLSGHILREMVHACLLPGATRQSW 100 >gb|ATQ36717.1| ribosomal protein S14 (chloroplast) [Sonchus arvensis] Length = 100 Score = 169 bits (428), Expect = 4e-51 Identities = 85/100 (85%), Positives = 86/100 (86%) Frame = -2 Query: 354 MAKKSLIXXXXXXXXXXXKYHSIRRSLKEEISKVRSLSDKWEIYGKLQSLPRNSAPTRLH 175 MAKKSLI KYH IRRS K+EISKVRSLSDKWEIYGKLQS PRNSAPTRLH Sbjct: 1 MAKKSLIQRSRQEQHLGQKYHLIRRSSKKEISKVRSLSDKWEIYGKLQSPPRNSAPTRLH 60 Query: 174 RRCFSTGRPRANYRDFGLSGHILREMVHACLLPGATRSSW 55 RRCFSTGRPRANYRDFGLSGHILREMVHACLLPGATRSSW Sbjct: 61 RRCFSTGRPRANYRDFGLSGHILREMVHACLLPGATRSSW 100 >gb|ATQ36713.1| ribosomal protein S14 (chloroplast) [Parthenium hysterophorus] Length = 100 Score = 169 bits (428), Expect = 4e-51 Identities = 85/100 (85%), Positives = 86/100 (86%) Frame = -2 Query: 354 MAKKSLIXXXXXXXXXXXKYHSIRRSLKEEISKVRSLSDKWEIYGKLQSLPRNSAPTRLH 175 MAKKSLI KYH IRRS K+EISKVRSLSDKWEIYGKLQS PRNSAPTRLH Sbjct: 1 MAKKSLIPRLVRKQHFGQKYHLIRRSSKKEISKVRSLSDKWEIYGKLQSPPRNSAPTRLH 60 Query: 174 RRCFSTGRPRANYRDFGLSGHILREMVHACLLPGATRSSW 55 RRCFSTGRPRANYRDFGLSGHILREMVHACLLPGATRSSW Sbjct: 61 RRCFSTGRPRANYRDFGLSGHILREMVHACLLPGATRSSW 100 >ref|YP_398327.1| ribosomal protein S14 [Lactuca sativa] ref|YP_001837358.1| ribosomal protein S14 [Guizotia abyssinica] ref|YP_003330960.1| ribosomal protein S14 [Parthenium argentatum] ref|YP_004564370.1| ribosomal protein S14 (chloroplast) [Ageratina adenophora] ref|YP_009020741.1| ribosomal protein S19 (chloroplast) [Praxelis clematidea] ref|YP_009154784.1| ribosomal protein S14 (chloroplast) [Aster spathulifolius] ref|YP_009271380.1| ribosomal protein S14 (chloroplast) [Taraxacum officinale] ref|YP_009307477.1| ribosomal protein S14 (chloroplast) [Taraxacum platycarpum] ref|YP_009307564.1| ribosomal protein S14 (chloroplast) [Taraxacum mongolicum] ref|YP_009316543.1| ribosomal protein S14 (chloroplast) [Taraxacum obtusifrons] ref|YP_009316628.1| ribosomal protein S14 (chloroplast) [Taraxacum amplum] ref|YP_009317298.1| ribosomal protein S14 (chloroplast) [Mikania micrantha] ref|YP_009317994.1| ribosomal protein S14 (chloroplast) [Galinsoga quadriradiata] ref|YP_009327484.1| ribosomal protein S14 (chloroplast) [Taraxacum brevicorniculatum] ref|YP_009327566.1| ribosomal protein S14 (chloroplast) [Taraxacum kok-saghyz] ref|YP_009354884.1| ribosomal protein S14 (plastid) [Echinacea angustifolia] ref|YP_009354629.1| ribosomal protein S14 (plastid) [Echinacea pallida] ref|YP_009354714.1| ribosomal protein S14 (plastid) [Echinacea laevigata] ref|YP_009354799.1| ribosomal protein S14 (plastid) [Echinacea atrorubens] ref|YP_009354969.1| ribosomal protein S14 (plastid) [Echinacea speciosa] ref|YP_009355054.1| ribosomal protein S14 (plastid) [Echinacea tennesseensis] ref|YP_009355139.1| ribosomal protein S14 (plastid) [Echinacea purpurea] ref|YP_009355224.1| ribosomal protein S14 (plastid) [Echinacea sanguinea] ref|YP_009354544.1| ribosomal protein S14 (plastid) [Echinacea paradoxa] ref|YP_009371293.1| ribosomal protein S14 (chloroplast) [Diplostephium pulchrum] ref|YP_009371378.1| ribosomal protein S14 (chloroplast) [Diplostephium jelskii] ref|YP_009372228.1| ribosomal protein S14 (chloroplast) [Diplostephium huertasii] ref|YP_009371633.1| ribosomal protein S14 (chloroplast) [Diplostephium juniperinum] ref|YP_009372483.1| ribosomal protein S14 (chloroplast) [Diplostephium obtusum] ref|YP_009371718.1| ribosomal protein S14 (chloroplast) [Diplostephium oxapampanum] ref|YP_009371463.1| ribosomal protein S14 (chloroplast) [Diplostephium lechleri] ref|YP_009371888.1| ribosomal protein S14 (chloroplast) [Diplostephium violaceum] ref|YP_009371973.1| ribosomal protein S14 (chloroplast) [Diplostephium oblongifolium] ref|YP_009371548.1| ribosomal protein S14 (chloroplast) [Lagenophora cuchumatanica] ref|YP_009371803.1| ribosomal protein S14 (chloroplast) [Diplostephium rhododendroides] ref|YP_009372058.1| ribosomal protein S14 (chloroplast) [Llerasia caucana] ref|YP_009372143.1| ribosomal protein S14 (chloroplast) [Diplostephium juajibioyi] ref|YP_009372313.1| ribosomal protein S14 (chloroplast) [Diplostephium spinulosum] ref|YP_009372398.1| ribosomal protein S14 (chloroplast) [Diplostephium meyenii] ref|YP_009372568.1| ribosomal protein S14 (chloroplast) [Diplostephium tachirense] ref|YP_009372653.1| ribosomal protein S14 (chloroplast) [Diplostephium serratifolium] ref|YP_009372738.1| ribosomal protein S14 (chloroplast) [Diplostephium mutiscuanum] ref|YP_009372823.1| ribosomal protein S14 (chloroplast) [Diplostephium sagasteguii] ref|YP_009372908.1| ribosomal protein S14 (chloroplast) [Diplostephium jenesanum] ref|YP_009372992.1| ribosomal protein S14 (chloroplast) [Diplostephium oblanceolatum] ref|YP_009373077.1| ribosomal protein S14 (chloroplast) [Diplostephium hippophae] ref|YP_009373162.1| ribosomal protein S14 (chloroplast) [Diplostephium hartwegii] ref|YP_009373489.1| ribosomal protein S14 (chloroplast) [Diplostephium alveolatum] ref|YP_009373574.1| ribosomal protein S14 (chloroplast) [Archibaccharis asperifolia] ref|YP_009373659.1| ribosomal protein S14 (chloroplast) [Oritrophium peruvianum] ref|YP_009373744.1| ribosomal protein S14 (chloroplast) [Diplostephium cinerascens] ref|YP_009374083.1| ribosomal protein S14 (chloroplast) [Diplostephium glandulosum] ref|YP_009374168.1| ribosomal protein S14 (chloroplast) [Heterothalamus alienus] ref|YP_009374253.1| ribosomal protein S14 (chloroplast) [Diplostephium callilepis] ref|YP_009374338.1| ribosomal protein S14 (chloroplast) [Diplostephium floribundum] ref|YP_009374423.1| ribosomal protein S14 (chloroplast) [Laestadia muscicola] ref|YP_009374508.1| ribosomal protein S14 (chloroplast) [Diplostephium rhomboidale] ref|YP_009374763.1| ribosomal protein S14 (chloroplast) [Diplostephium gynoxyoides] ref|YP_009375613.1| ribosomal protein S14 (chloroplast) [Diplostephium cajamarquillense] ref|YP_009376463.1| ribosomal protein S14 (chloroplast) [Diplostephium azureum] ref|YP_009376548.1| ribosomal protein S14 (chloroplast) [Diplostephium foliosissimum] ref|YP_009376633.1| ribosomal protein S14 (chloroplast) [Hinterhubera ericoides] ref|YP_009376803.1| ribosomal protein S14 (chloroplast) [Diplostephium cayambense] ref|YP_009376973.1| ribosomal protein S14 (chloroplast) [Floscaldasia hypsophila] ref|YP_009377143.1| ribosomal protein S14 (chloroplast) [Parastrephia quadrangularis] ref|YP_009377483.1| ribosomal protein S14 (chloroplast) [Diplostephium jaramilloi] ref|YP_009377653.1| ribosomal protein S14 (chloroplast) [Diplostephium heterophyllum] ref|YP_009377738.1| ribosomal protein S14 (chloroplast) [Diplostephium camargoanum] ref|YP_009378248.1| ribosomal protein S14 (chloroplast) [Diplostephium ochraceum] ref|YP_009374593.1| ribosomal protein S14 (chloroplast) [Diplostephium tenuifolium] ref|YP_009374678.1| ribosomal protein S14 (chloroplast) [Diplostephium colombianum] ref|YP_009374848.1| ribosomal protein S14 (chloroplast) [Diplostephium revolutum] ref|YP_009374933.1| ribosomal protein S14 (chloroplast) [Exostigma notobellidiastrum] ref|YP_009375018.1| ribosomal protein S14 (chloroplast) [Diplostephium rupestre] ref|YP_009375103.1| ribosomal protein S14 (chloroplast) [Blakiella bartsiifolia] ref|YP_009375188.1| ribosomal protein S14 (chloroplast) [Diplostephium gnidioides] ref|YP_009375358.1| ribosomal protein S14 (chloroplast) [Diplostephium cinereum] ref|YP_009375443.1| ribosomal protein S14 (chloroplast) [Diplostephium ericoides] ref|YP_009375528.1| ribosomal protein S14 (chloroplast) [Diplostephium haenkei] ref|YP_009375698.1| ribosomal protein S14 (chloroplast) [Diplostephium phylicoides] ref|YP_009375783.1| ribosomal protein S14 (chloroplast) [Diplostephium eriophorum] ref|YP_009375868.1| ribosomal protein S14 (chloroplast) [Diplostephium glutinosum] ref|YP_009375953.1| ribosomal protein S14 (chloroplast) [Diplostephium antioquense] ref|YP_009376038.1| ribosomal protein S14 (chloroplast) [Laennecia sophiifolia] ref|YP_009376123.1| ribosomal protein S14 (chloroplast) [Diplostephium lacunosum] ref|YP_009376208.1| ribosomal protein S14 (chloroplast) [Diplostephium costaricense] ref|YP_009376293.1| ribosomal protein S14 (chloroplast) [Diplostephium espinosae] ref|YP_009376378.1| ribosomal protein S14 (chloroplast) [Diplostephium crypteriophyllum] ref|YP_009376718.1| ribosomal protein S14 (chloroplast) [Diplostephium romeroi] ref|YP_009376888.1| ribosomal protein S14 (chloroplast) [Diplostephium venezuelense] ref|YP_009377058.1| ribosomal protein S14 (chloroplast) [Westoniella kohkemperi] ref|YP_009377228.1| ribosomal protein S14 (chloroplast) [Diplostephium empetrifolium] ref|YP_009377313.1| ribosomal protein S14 (chloroplast) [Diplostephium schultzii] ref|YP_009377398.1| ribosomal protein S14 (chloroplast) [Diplostephium frontinense] ref|YP_009377568.1| ribosomal protein S14 (chloroplast) [Diplostephium inesianum] ref|YP_009377823.1| ribosomal protein S14 (chloroplast) [Aztecaster matudae] ref|YP_009377908.1| ribosomal protein S14 (chloroplast) [Diplostephium coriaceum] ref|YP_009377993.1| ribosomal protein S14 (chloroplast) [Diplostephium rosmarinifolium] ref|YP_009378078.1| ribosomal protein S14 (chloroplast) [Diplostephium goodspeedii] ref|YP_009378163.1| ribosomal protein S14 (chloroplast) [Diplostephium apiculatum] ref|YP_009427989.1| ribosomal protein S14 (chloroplast) [Ambrosia artemisiifolia] ref|YP_009447365.1| ribosomal protein S14 (chloroplast) [Achyrachaena mollis] sp|Q332Y0.1|RR14_LACSA RecName: Full=30S ribosomal protein S14, chloroplastic sp|B2LMJ1.1|RR14_GUIAB RecName: Full=30S ribosomal protein S14, chloroplastic dbj|BAE47592.1| chloroplast 30S ribosomal protein S14 (chloroplast) [Lactuca sativa] gb|ABD47231.1| ribosomal protein S14 (chloroplast) [Lactuca sativa] gb|ACB86525.1| ribosomal protein S14 (chloroplast) [Guizotia abyssinica] gb|ACZ52709.1| ribosomal protein S14 (chloroplast) [Parthenium argentatum] gb|AEG64554.1| ribosomal protein S14 (chloroplast) [Ageratina adenophora] gb|AGX29678.1| ribosomal protein S14 (chloroplast) [Aster spathulifolius] gb|AHM02401.1| ribosomal protein S19 (chloroplast) [Praxelis clematidea] gb|AIW51845.1| ribosomal protein S14 (chloroplast) [Lasthenia burkei] gb|AJE73061.1| ribosomal protein S14 (plastid) [Xanthisma spinulosum] gb|AJE73137.1| ribosomal protein S14 (plastid) [Gutierrezia sarothrae] gb|AJE73213.1| ribosomal protein S14 (plastid) [Liatris squarrosa] gb|AJE73593.1| ribosomal protein S14 (plastid) [Solidago canadensis var. scabra] gb|AJE73745.1| ribosomal protein S14 (plastid) [Heterotheca stenophylla] gb|AJE73973.1| ribosomal protein S14 (plastid) [Helenium flexuosum] gb|AJE74049.1| ribosomal protein S14 (plastid) [Heterotheca villosa] gb|AJE74201.1| ribosomal protein S14 (plastid) [Echinacea angustifolia] gb|AJE74505.1| ribosomal protein S14 (plastid) [Lactuca ludoviciana] gb|AJE74581.1| ribosomal protein S14 (plastid) [Ratibida columnifera] gb|AJE74657.1| ribosomal protein S14 (plastid) [Lygodesmia juncea] gb|AJE74733.1| ribosomal protein S14 (plastid) [Hymenopappus tenuifolius] gb|AJE74885.1| ribosomal protein S14 (plastid) [Solidago gigantea] gb|AJE75113.1| ribosomal protein S14 (plastid) [Tragopogon dubius] gb|AKZ24244.1| ribosomal protein S14 (plastid) [Rudbeckia hirta var. pulcherrima] gb|AKZ24245.1| ribosomal protein S14 (plastid) [Silphium integrifolium] gb|AKZ24246.1| ribosomal protein S14 (plastid) [Heliopsis helianthoides var. occidentalis] gb|AKZ24247.1| ribosomal protein S14 (plastid) [Grindelia squarrosa var. squarrosa] gb|ANW47874.1| ribosomal protein S14 (chloroplast) [Taraxacum officinale] gb|AOR82224.1| ribosomal protein S14 (chloroplast) [Taraxacum platycarpum] gb|AOR82311.1| ribosomal protein S14 (chloroplast) [Taraxacum mongolicum] gb|AOV93762.1| ribosomal protein S14 (chloroplast) [Taraxacum sp. RHS-2016] gb|AOV93847.1| ribosomal protein S14 (chloroplast) [Taraxacum obtusifrons] gb|AOV93931.1| ribosomal protein S14 (chloroplast) [Taraxacum amplum] gb|AOX22880.1| ribosomal protein S14 (chloroplast) [Mikania micrantha] gb|AOY41673.1| ribosomal protein S14 (chloroplast) [Galinsoga quadriradiata] gb|APA33610.1| ribosomal protein S14 (chloroplast) [Taraxacum brevicorniculatum] gb|APA33692.1| ribosomal protein S14 (chloroplast) [Taraxacum kok-saghyz] gb|APA33774.1| ribosomal protein S14 (chloroplast) [Taraxacum officinale] gb|AQX33557.1| ribosomal protein S14 (chloroplast) [Pityopsis falcata] gb|ARB02753.1| ribosomal protein S14 (plastid) [Echinacea paradoxa] gb|ARB02838.1| ribosomal protein S14 (plastid) [Echinacea pallida] gb|ARB02923.1| ribosomal protein S14 (plastid) [Echinacea laevigata] gb|ARB03008.1| ribosomal protein S14 (plastid) [Echinacea atrorubens] gb|ARB03093.1| ribosomal protein S14 (plastid) [Echinacea angustifolia] gb|ARB03178.1| ribosomal protein S14 (plastid) [Echinacea speciosa] gb|ARB03263.1| ribosomal protein S14 (plastid) [Echinacea tennesseensis] gb|ARB03348.1| ribosomal protein S14 (plastid) [Echinacea purpurea] gb|ARB03433.1| ribosomal protein S14 (plastid) [Echinacea sanguinea] gb|ARH02864.1| ribosomal protein S14 (chloroplast) [Diplostephium alveolatum] gb|ARH02949.1| ribosomal protein S14 (chloroplast) [Diplostephium pulchrum] gb|ARH03034.1| ribosomal protein S14 (chloroplast) [Diplostephium sp. CAJ2] gb|ARH03119.1| ribosomal protein S14 (chloroplast) [Archibaccharis asperifolia] gb|ARH03204.1| ribosomal protein S14 (chloroplast) [Diplostephium jelskii] gb|ARH03289.1| ribosomal protein S14 (chloroplast) [Oritrophium peruvianum] gb|ARH03374.1| ribosomal protein S14 (chloroplast) [Diplostephium cinerascens] gb|ARH03713.1| ribosomal protein S14 (chloroplast) [Diplostephium glandulosum] gb|ARH03798.1| ribosomal protein S14 (chloroplast) [Diplostephium sp. CAJ2] gb|ARH03883.1| ribosomal protein S14 (chloroplast) [Diplostephium lechleri] gb|ARH03968.1| ribosomal protein S14 (chloroplast) [Heterothalamus alienus] gb|ARH04053.1| ribosomal protein S14 (chloroplast) [Diplostephium callilepis] gb|ARH04138.1| ribosomal protein S14 (chloroplast) [Diplostephium sp. CAJ2] gb|ARH04223.1| ribosomal protein S14 (chloroplast) [Diplostephium floribundum] gb|ARH04308.1| ribosomal protein S14 (chloroplast) [Laestadia muscicola] gb|ARH04393.1| ribosomal protein S14 (chloroplast) [Diplostephium rhomboidale] gb|ARH04478.1| ribosomal protein S14 (chloroplast) [Diplostephium tenuifolium] gb|ARH04563.1| ribosomal protein S14 (chloroplast) [Diplostephium colombianum] gb|ARH04648.1| ribosomal protein S14 (chloroplast) [Diplostephium gynoxyoides] gb|ARH04733.1| ribosomal protein S14 (chloroplast) [Diplostephium revolutum] gb|ARH04818.1| ribosomal protein S14 (chloroplast) [Lagenophora cuchumatanica] gb|ARH04903.1| ribosomal protein S14 (chloroplast) [Diplostephium hartwegii] gb|ARH04988.1| ribosomal protein S14 (chloroplast) [Exostigma notobellidiastrum] gb|ARH05073.1| ribosomal protein S14 (chloroplast) [Diplostephium rupestre] gb|ARH05158.1| ribosomal protein S14 (chloroplast) [Diplostephium juniperinum] gb|ARH05243.1| ribosomal protein S14 (chloroplast) [Diplostephium oxapampanum] gb|ARH05328.1| ribosomal protein S14 (chloroplast) [Diplostephium rhododendroides] gb|ARH05413.1| ribosomal protein S14 (chloroplast) [Blakiella bartsiifolia] gb|ARH05498.1| ribosomal protein S14 (chloroplast) [Diplostephium gnidioides] gb|ARH05668.1| ribosomal protein S14 (chloroplast) [Diplostephium cinereum] gb|ARH05753.1| ribosomal protein S14 (chloroplast) [Diplostephium rhomboidale] gb|ARH05838.1| ribosomal protein S14 (chloroplast) [Diplostephium violaceum] gb|ARH05923.1| ribosomal protein S14 (chloroplast) [Diplostephium ericoides] gb|ARH06008.1| ribosomal protein S14 (chloroplast) [Diplostephium haenkei] gb|ARH06093.1| ribosomal protein S14 (chloroplast) [Diplostephium cajamarquillense] gb|ARH06178.1| ribosomal protein S14 (chloroplast) [Diplostephium phylicoides] gb|ARH06263.1| ribosomal protein S14 (chloroplast) [Diplostephium eriophorum] gb|ARH06348.1| ribosomal protein S14 (chloroplast) [Diplostephium glutinosum] gb|ARH06433.1| ribosomal protein S14 (chloroplast) [Diplostephium antioquense] gb|ARH06518.1| ribosomal protein S14 (chloroplast) [Laennecia sophiifolia] gb|ARH06603.1| ribosomal protein S14 (chloroplast) [Diplostephium lacunosum] gb|ARH06688.1| ribosomal protein S14 (chloroplast) [Diplostephium costaricense] gb|ARH06773.1| ribosomal protein S14 (chloroplast) [Diplostephium sp. CAJ2] gb|ARH06858.1| ribosomal protein S14 (chloroplast) [Diplostephium espinosae] gb|ARH06943.1| ribosomal protein S14 (chloroplast) [Diplostephium sp. CAJ2] gb|ARH07028.1| ribosomal protein S14 (chloroplast) [Diplostephium crypteriophyllum] gb|ARH07113.1| ribosomal protein S14 (chloroplast) [Diplostephium oblongifolium] gb|ARH07198.1| ribosomal protein S14 (chloroplast) [Diplostephium azureum] gb|ARH07283.1| ribosomal protein S14 (chloroplast) [Llerasia caucana] gb|ARH07368.1| ribosomal protein S14 (chloroplast) [Diplostephium foliosissimum] gb|ARH07453.1| ribosomal protein S14 (chloroplast) [Hinterhubera ericoides] gb|ARH07538.1| ribosomal protein S14 (chloroplast) [Diplostephium romeroi] gb|ARH07623.1| ribosomal protein S14 (chloroplast) [Diplostephium cayambense] gb|ARH07708.1| ribosomal protein S14 (chloroplast) [Diplostephium juajibioyi] gb|ARH07793.1| ribosomal protein S14 (chloroplast) [Diplostephium venezuelense] gb|ARH07878.1| ribosomal protein S14 (chloroplast) [Diplostephium huertasii] gb|ARH07963.1| ribosomal protein S14 (chloroplast) [Floscaldasia hypsophila] gb|ARH08048.1| ribosomal protein S14 (chloroplast) [Diplostephium spinulosum] gb|ARH08133.1| ribosomal protein S14 (chloroplast) [Diplostephium sp. CAJ2] gb|ARH08218.1| ribosomal protein S14 (chloroplast) [Diplostephium meyenii] gb|ARH08303.1| ribosomal protein S14 (chloroplast) [Diplostephium obtusum] gb|ARH08388.1| ribosomal protein S14 (chloroplast) [Westoniella kohkemperi] gb|ARH08473.1| ribosomal protein S14 (chloroplast) [Diplostephium tachirense] gb|ARH08558.1| ribosomal protein S14 (chloroplast) [Parastrephia quadrangularis] gb|ARH08643.1| ribosomal protein S14 (chloroplast) [Diplostephium serratifolium] gb|ARH08728.1| ribosomal protein S14 (chloroplast) [Diplostephium empetrifolium] gb|ARH08813.1| ribosomal protein S14 (chloroplast) [Diplostephium schultzii] gb|ARH08898.1| ribosomal protein S14 (chloroplast) [Diplostephium frontinense] gb|ARH08983.1| ribosomal protein S14 (chloroplast) [Diplostephium jaramilloi] gb|ARH09068.1| ribosomal protein S14 (chloroplast) [Diplostephium mutiscuanum] gb|ARH09153.1| ribosomal protein S14 (chloroplast) [Diplostephium inesianum] gb|ARH09238.1| ribosomal protein S14 (chloroplast) [Diplostephium heterophyllum] gb|ARH09323.1| ribosomal protein S14 (chloroplast) [Diplostephium sagasteguii] gb|ARH09408.1| ribosomal protein S14 (chloroplast) [Diplostephium camargoanum] gb|ARH09493.1| ribosomal protein S14 (chloroplast) [Diplostephium jenesanum] gb|ARH09577.1| ribosomal protein S14 (chloroplast) [Aztecaster matudae] gb|ARH09662.1| ribosomal protein S14 (chloroplast) [Diplostephium schultzii] gb|ARH09747.1| ribosomal protein S14 (chloroplast) [Diplostephium coriaceum] gb|ARH09832.1| ribosomal protein S14 (chloroplast) [Diplostephium sp. CAJ2] gb|ARH09917.1| ribosomal protein S14 (chloroplast) [Diplostephium rosmarinifolium] gb|ARH10002.1| ribosomal protein S14 (chloroplast) [Diplostephium goodspeedii] gb|ARH10087.1| ribosomal protein S14 (chloroplast) [Diplostephium oblanceolatum] gb|ARH10172.1| ribosomal protein S14 (chloroplast) [Diplostephium pulchrum] gb|ARH10257.1| ribosomal protein S14 (chloroplast) [Diplostephium apiculatum] gb|ARH10342.1| ribosomal protein S14 (chloroplast) [Diplostephium hippophae] gb|ARH10427.1| ribosomal protein S14 (chloroplast) [Diplostephium ochraceum] gb|ARH10512.1| ribosomal protein S14 (chloroplast) [Diplostephium sp. CAJ2] gb|ASU96418.1| ribosomal protein S14 (chloroplast) [Lasthenia californica] gb|ASV47865.1| ribosomal protein S14 (chloroplast) [Ambrosia artemisiifolia] gb|ATC70019.1| ribosomal protein S14 (chloroplast) [Atractylodes lancea] gb|ATL16497.1| ribosomal protein S14 (chloroplast) [Atractylodes macrocephala] gb|ATY69650.1| ribosomal protein S14 (chloroplast) [Achyrachaena mollis] Length = 100 Score = 169 bits (428), Expect = 4e-51 Identities = 85/100 (85%), Positives = 86/100 (86%) Frame = -2 Query: 354 MAKKSLIXXXXXXXXXXXKYHSIRRSLKEEISKVRSLSDKWEIYGKLQSLPRNSAPTRLH 175 MAKKSLI KYH IRRS K+EISKVRSLSDKWEIYGKLQS PRNSAPTRLH Sbjct: 1 MAKKSLIQREKKRQKLEQKYHLIRRSSKKEISKVRSLSDKWEIYGKLQSPPRNSAPTRLH 60 Query: 174 RRCFSTGRPRANYRDFGLSGHILREMVHACLLPGATRSSW 55 RRCFSTGRPRANYRDFGLSGHILREMVHACLLPGATRSSW Sbjct: 61 RRCFSTGRPRANYRDFGLSGHILREMVHACLLPGATRSSW 100 >gb|AJE73897.1| ribosomal protein S14 (plastid) [Vernonia baldwinii] gb|AKZ24241.1| ribosomal protein S14 (plastid) [Vernonia baldwinii] Length = 100 Score = 169 bits (428), Expect = 4e-51 Identities = 85/100 (85%), Positives = 86/100 (86%) Frame = -2 Query: 354 MAKKSLIXXXXXXXXXXXKYHSIRRSLKEEISKVRSLSDKWEIYGKLQSLPRNSAPTRLH 175 MAKKSLI KYH IRRS K+EISKVRSLSDKWEIYGKLQS PRNSAPTRLH Sbjct: 1 MAKKSLIQREKKREKLEQKYHLIRRSSKKEISKVRSLSDKWEIYGKLQSPPRNSAPTRLH 60 Query: 174 RRCFSTGRPRANYRDFGLSGHILREMVHACLLPGATRSSW 55 RRCFSTGRPRANYRDFGLSGHILREMVHACLLPGATRSSW Sbjct: 61 RRCFSTGRPRANYRDFGLSGHILREMVHACLLPGATRSSW 100 >ref|NP_783230.1| ribosomal protein S14 [Atropa belladonna] ref|YP_006666028.1| ribosomal protein S14 (chloroplast) [Capsicum annuum] ref|YP_009040316.1| ribosomal protein S14 [Hyoscyamus niger] ref|YP_009169666.1| ribosomal protein S14 (chloroplast) [Capsicum frutescens] ref|YP_009262861.1| ribosomal protein S14 (chloroplast) [Capsicum chinense] ref|YP_009344248.1| ribosomal protein S14 (chloroplast) [Capsicum eximium] ref|YP_009343987.1| ribosomal protein S14 (chloroplast) [Capsicum galapagoense] ref|YP_009344074.1| ribosomal protein S14 (chloroplast) [Capsicum chacoense] ref|YP_009344161.1| ribosomal protein S14 (chloroplast) [Capsicum tovarii] sp|Q8S8X6.1|RR14_ATRBE RecName: Full=30S ribosomal protein S14, chloroplastic emb|CAC88042.1| ribosomal protein S14 (chloroplast) [Atropa belladonna] gb|AFP90774.1| ribosomal protein S14 (chloroplast) [Capsicum annuum] gb|AGU46464.1| ribosomal protein S14 (plastid) [Hyoscyamus niger] gb|AIA76960.1| ribosomal protein S14 (chloroplast) (chloroplast) [Capsicum annuum var. glabriusculum] gb|ALD50101.1| ribosomal protein S14 (chloroplast) [Capsicum annuum var. glabriusculum] gb|ALD50187.1| ribosomal protein S14 (chloroplast) [Capsicum frutescens] gb|ALD50273.1| ribosomal protein S14 (chloroplast) [Capsicum annuum var. annuum] gb|ALD50359.1| ribosomal protein S14 (chloroplast) [Capsicum baccatum var. baccatum] gb|ANJ03955.1| ribosomal protein S14 (chloroplast) [Capsicum chinense] gb|APT41633.1| ribosomal protein S14 (chloroplast) [Capsicum galapagoense] gb|APT41720.1| ribosomal protein S14 (chloroplast) [Capsicum chinense] gb|APT41807.1| ribosomal protein S14 (chloroplast) [Capsicum chacoense] gb|APT41894.1| ribosomal protein S14 (chloroplast) [Capsicum tovarii] gb|APT41981.1| ribosomal protein S14 (chloroplast) [Capsicum eximium] gb|PHT51432.1| 30S ribosomal protein S14, chloroplastic [Capsicum baccatum] gb|PHT74270.1| 30S ribosomal protein S14, chloroplastic [Capsicum annuum] gb|PHT85432.1| 30S ribosomal protein S14, chloroplastic [Capsicum annuum] gb|PHT95627.1| 30S ribosomal protein S14, chloroplastic [Capsicum annuum] gb|PHT96957.1| 30S ribosomal protein S14, chloroplastic [Capsicum chinense] gb|PHT99967.1| hypothetical protein BC332_29755 [Capsicum chinense] Length = 100 Score = 169 bits (428), Expect = 4e-51 Identities = 85/100 (85%), Positives = 86/100 (86%) Frame = -2 Query: 354 MAKKSLIXXXXXXXXXXXKYHSIRRSLKEEISKVRSLSDKWEIYGKLQSLPRNSAPTRLH 175 MAKKSLI KYHSIRRS K+EISKV SLSDKWEIYGKLQSLPRNSAPTRLH Sbjct: 1 MAKKSLIQREKKRQKLEQKYHSIRRSSKKEISKVPSLSDKWEIYGKLQSLPRNSAPTRLH 60 Query: 174 RRCFSTGRPRANYRDFGLSGHILREMVHACLLPGATRSSW 55 RRCF TGRPRANYRDFGLSGHILREMVHACLLPGATRSSW Sbjct: 61 RRCFLTGRPRANYRDFGLSGHILREMVHACLLPGATRSSW 100