BLASTX nr result
ID: Chrysanthemum22_contig00027003
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00027003 (569 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021640878.1| topless-related protein 4-like isoform X4 [H... 52 4e-06 >ref|XP_021640878.1| topless-related protein 4-like isoform X4 [Hevea brasiliensis] Length = 1102 Score = 52.4 bits (124), Expect(2) = 4e-06 Identities = 25/39 (64%), Positives = 31/39 (79%) Frame = -1 Query: 299 MQMLANPDGVRLLRTTENRSFDASGVAPASVGKGKDNHT 183 +++LAN DG+RLLRT ENR+FDAS VA A+V K DN T Sbjct: 664 VKILANSDGIRLLRTVENRTFDASRVASAAVVKNSDNRT 702 Score = 25.8 bits (55), Expect(2) = 4e-06 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = -3 Query: 351 SPFVRSNKDGMLLAILIHANASK 283 +P +R NKDG LLA+ + N+ K Sbjct: 643 APCIRFNKDGALLAVSTNDNSVK 665