BLASTX nr result
ID: Chrysanthemum22_contig00026835
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00026835 (562 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KYP41237.1| hypothetical protein KK1_037401, partial [Cajanus... 53 5e-06 ref|YP_009049680.1| hypothetical protein (mitochondrion) [Capsic... 53 6e-06 >gb|KYP41237.1| hypothetical protein KK1_037401, partial [Cajanus cajan] Length = 95 Score = 53.1 bits (126), Expect = 5e-06 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = -3 Query: 560 GGD*STCTPATTTKSSGVNAPAIAVQPFLGFVE 462 G D TC PA+TTKSSG+NAP AVQPFLGFVE Sbjct: 9 GWDSFTCIPASTTKSSGLNAPTTAVQPFLGFVE 41 >ref|YP_009049680.1| hypothetical protein (mitochondrion) [Capsicum annuum] gb|AIG89911.1| hypothetical protein (mitochondrion) [Capsicum annuum] gb|AIG90038.1| hypothetical protein (mitochondrion) [Capsicum annuum] gb|PHT94485.1| hypothetical protein T459_02367 [Capsicum annuum] Length = 105 Score = 53.1 bits (126), Expect = 6e-06 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = -3 Query: 560 GGD*STCTPATTTKSSGVNAPAIAVQPFLGFVE 462 G D TC PA+TTKSSG+NAP AVQPFLGFVE Sbjct: 19 GWDSFTCIPASTTKSSGLNAPTTAVQPFLGFVE 51