BLASTX nr result
ID: Chrysanthemum22_contig00026751
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00026751 (530 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023756563.1| RGG repeats nuclear RNA binding protein A-li... 50 4e-07 >ref|XP_023756563.1| RGG repeats nuclear RNA binding protein A-like [Lactuca sativa] gb|PLY90837.1| hypothetical protein LSAT_6X94060 [Lactuca sativa] Length = 355 Score = 50.1 bits (118), Expect(2) = 4e-07 Identities = 24/42 (57%), Positives = 31/42 (73%) Frame = -3 Query: 291 EEVAETEKNVDSEKQEE*ADTNKENSIKVMEVKEPEDNALRL 166 E V ETEK VDSEKQE AD N+EN++ V+E K+PE+ + L Sbjct: 186 EPVTETEKIVDSEKQENGADANQENTVDVVEEKKPEEKEMTL 227 Score = 31.6 bits (70), Expect(2) = 4e-07 Identities = 13/22 (59%), Positives = 18/22 (81%) Frame = -1 Query: 365 KRPKRVF*QHNGIGCGNKFKRE 300 +RP+RVF + +G G GN+FKRE Sbjct: 145 ERPRRVFERRSGTGRGNEFKRE 166