BLASTX nr result
ID: Chrysanthemum22_contig00026717
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00026717 (761 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PLY98303.1| hypothetical protein LSAT_7X101080 [Lactuca sativa] 55 7e-08 >gb|PLY98303.1| hypothetical protein LSAT_7X101080 [Lactuca sativa] Length = 337 Score = 54.7 bits (130), Expect(2) = 7e-08 Identities = 25/62 (40%), Positives = 39/62 (62%) Frame = -3 Query: 756 KATVLQCFPSQEEGS*TTSQRDVVIVNEEKRLLLLMSWLQLDEIEWNILTKLRPGAMAFG 577 + VLQC PSQE G ++RD++I+N+EK LL + W + DE E +L +R + FG Sbjct: 79 RGIVLQCLPSQEHGVDLLTRRDIIIINKEKILLHVTLWKEFDEHEGRMLEAIRQPPLIFG 138 Query: 576 IK 571 ++ Sbjct: 139 LR 140 Score = 30.8 bits (68), Expect(2) = 7e-08 Identities = 15/39 (38%), Positives = 25/39 (64%) Frame = -2 Query: 589 YGLRNQDLKCHTGILLTARGSSGFMIHPPFTHELQMK*W 473 +GLR + + I LT R ++ FMI+PP + +LQ++ W Sbjct: 137 FGLRLK-VTTFNSISLTTRPNTTFMINPPVSEDLQLRKW 174