BLASTX nr result
ID: Chrysanthemum22_contig00026669
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00026669 (397 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010927328.1| PREDICTED: chromatin remodeling protein EBS ... 123 4e-33 gb|EOX93307.1| PHD finger family protein / bromo-adjacent (BAH) ... 122 8e-33 gb|PPR83752.1| hypothetical protein GOBAR_AA36960 [Gossypium bar... 122 8e-33 ref|XP_021890101.1| chromatin remodeling protein EBS-like isofor... 122 9e-33 ref|XP_010928227.1| PREDICTED: chromatin remodeling protein EBS ... 122 1e-32 ref|XP_010546594.1| PREDICTED: chromatin remodeling protein EBS-... 122 2e-32 gb|PKU62232.1| hypothetical protein MA16_Dca027085 [Dendrobium c... 120 4e-32 ref|XP_020672914.1| chromatin remodeling protein EBS isoform X2 ... 121 7e-32 ref|XP_020672913.1| chromatin remodeling protein EBS isoform X1 ... 121 7e-32 gb|PKA50649.1| hypothetical protein AXF42_Ash017988 [Apostasia s... 121 9e-32 dbj|GAV72163.1| PHD domain-containing protein/BAH domain-contain... 121 9e-32 gb|PKU60016.1| PHD finger protein ALFIN-LIKE 3 [Dendrobium caten... 121 1e-31 ref|XP_020672829.1| chromatin remodeling protein EBS-like isofor... 120 1e-31 ref|XP_023891828.1| chromatin remodeling protein EBS isoform X2 ... 119 1e-31 ref|XP_023891827.1| chromatin remodeling protein EBS isoform X1 ... 119 1e-31 gb|OMO88861.1| hypothetical protein CCACVL1_08160 [Corchorus cap... 119 1e-31 gb|OAY83855.1| BAH and coiled-coil domain-containing protein 1 [... 119 1e-31 ref|XP_020270864.1| chromatin remodeling protein EBS-like [Aspar... 120 1e-31 gb|KDO54281.1| hypothetical protein CISIN_1g027093mg [Citrus sin... 119 1e-31 gb|PIA50568.1| hypothetical protein AQUCO_01200033v1 [Aquilegia ... 118 2e-31 >ref|XP_010927328.1| PREDICTED: chromatin remodeling protein EBS isoform X3 [Elaeis guineensis] Length = 178 Score = 123 bits (309), Expect = 4e-33 Identities = 53/56 (94%), Positives = 54/56 (96%) Frame = -1 Query: 322 YTKLENVGTEDYFCRFEYKAATGGFTPDRVAVYCKCEMPYNPDDLMVQCEECKDCH 155 YTKLENVGTEDYFCRFEY AATGGFTPDRVAVYCKCEMPYNPDDLMVQCE CKDC+ Sbjct: 108 YTKLENVGTEDYFCRFEYNAATGGFTPDRVAVYCKCEMPYNPDDLMVQCEGCKDCY 163 >gb|EOX93307.1| PHD finger family protein / bromo-adjacent (BAH) domain-containing protein isoform 3 [Theobroma cacao] Length = 175 Score = 122 bits (307), Expect = 8e-33 Identities = 53/55 (96%), Positives = 53/55 (96%) Frame = -1 Query: 322 YTKLENVGTEDYFCRFEYKAATGGFTPDRVAVYCKCEMPYNPDDLMVQCEECKDC 158 YTKLENVG EDYFCRFEYKAATGGFTPDRVAVYCKCEMPYNPDDLMVQCE CKDC Sbjct: 108 YTKLENVGAEDYFCRFEYKAATGGFTPDRVAVYCKCEMPYNPDDLMVQCEGCKDC 162 >gb|PPR83752.1| hypothetical protein GOBAR_AA36960 [Gossypium barbadense] Length = 176 Score = 122 bits (307), Expect = 8e-33 Identities = 53/55 (96%), Positives = 53/55 (96%) Frame = -1 Query: 322 YTKLENVGTEDYFCRFEYKAATGGFTPDRVAVYCKCEMPYNPDDLMVQCEECKDC 158 YTKLENVG EDYFCRFEYKAATGGFTPDRVAVYCKCEMPYNPDDLMVQCE CKDC Sbjct: 108 YTKLENVGAEDYFCRFEYKAATGGFTPDRVAVYCKCEMPYNPDDLMVQCEGCKDC 162 >ref|XP_021890101.1| chromatin remodeling protein EBS-like isoform X2 [Carica papaya] Length = 179 Score = 122 bits (307), Expect = 9e-33 Identities = 53/55 (96%), Positives = 53/55 (96%) Frame = -1 Query: 322 YTKLENVGTEDYFCRFEYKAATGGFTPDRVAVYCKCEMPYNPDDLMVQCEECKDC 158 YTKLENVG EDYFCRFEYKAATGGFTPDRVAVYCKCEMPYNPDDLMVQCE CKDC Sbjct: 108 YTKLENVGAEDYFCRFEYKAATGGFTPDRVAVYCKCEMPYNPDDLMVQCEGCKDC 162 >ref|XP_010928227.1| PREDICTED: chromatin remodeling protein EBS isoform X3 [Elaeis guineensis] Length = 186 Score = 122 bits (307), Expect = 1e-32 Identities = 53/55 (96%), Positives = 53/55 (96%) Frame = -1 Query: 322 YTKLENVGTEDYFCRFEYKAATGGFTPDRVAVYCKCEMPYNPDDLMVQCEECKDC 158 YTKLENVG EDYFCRFEYKAATGGFTPDRVAVYCKCEMPYNPDDLMVQCE CKDC Sbjct: 108 YTKLENVGAEDYFCRFEYKAATGGFTPDRVAVYCKCEMPYNPDDLMVQCEGCKDC 162 >ref|XP_010546594.1| PREDICTED: chromatin remodeling protein EBS-like isoform X2 [Tarenaya hassleriana] Length = 190 Score = 122 bits (306), Expect = 2e-32 Identities = 53/70 (75%), Positives = 60/70 (85%) Frame = -1 Query: 322 YTKLENVGTEDYFCRFEYKAATGGFTPDRVAVYCKCEMPYNPDDLMVQCEECKDCHSILG 143 YTKLENVG EDY+CRFEYKAATG FTPDRVAVYCKCEMPYNPDDLMVQCE CKDC ++ Sbjct: 118 YTKLENVGAEDYYCRFEYKAATGAFTPDRVAVYCKCEMPYNPDDLMVQCEGCKDCLLLVL 177 Query: 142 PFKRCSHAIV 113 PF + +++ Sbjct: 178 PFVGITRSVL 187 >gb|PKU62232.1| hypothetical protein MA16_Dca027085 [Dendrobium catenatum] Length = 162 Score = 120 bits (301), Expect = 4e-32 Identities = 52/54 (96%), Positives = 53/54 (98%) Frame = -1 Query: 322 YTKLENVGTEDYFCRFEYKAATGGFTPDRVAVYCKCEMPYNPDDLMVQCEECKD 161 YTKLENVGTEDYFCRFEYKA+TGGFTPDRVAVYCKCEMPYNPDDLMVQCE CKD Sbjct: 108 YTKLENVGTEDYFCRFEYKASTGGFTPDRVAVYCKCEMPYNPDDLMVQCEACKD 161 >ref|XP_020672914.1| chromatin remodeling protein EBS isoform X2 [Dendrobium catenatum] Length = 216 Score = 121 bits (304), Expect = 7e-32 Identities = 53/54 (98%), Positives = 53/54 (98%) Frame = -1 Query: 322 YTKLENVGTEDYFCRFEYKAATGGFTPDRVAVYCKCEMPYNPDDLMVQCEECKD 161 YTKLENVGTEDYFCRFEYKAATGGFTPDRVAVYCKCEMPYNPDDLMVQCE CKD Sbjct: 108 YTKLENVGTEDYFCRFEYKAATGGFTPDRVAVYCKCEMPYNPDDLMVQCEACKD 161 >ref|XP_020672913.1| chromatin remodeling protein EBS isoform X1 [Dendrobium catenatum] Length = 221 Score = 121 bits (304), Expect = 7e-32 Identities = 53/54 (98%), Positives = 53/54 (98%) Frame = -1 Query: 322 YTKLENVGTEDYFCRFEYKAATGGFTPDRVAVYCKCEMPYNPDDLMVQCEECKD 161 YTKLENVGTEDYFCRFEYKAATGGFTPDRVAVYCKCEMPYNPDDLMVQCE CKD Sbjct: 108 YTKLENVGTEDYFCRFEYKAATGGFTPDRVAVYCKCEMPYNPDDLMVQCEACKD 161 >gb|PKA50649.1| hypothetical protein AXF42_Ash017988 [Apostasia shenzhenica] Length = 228 Score = 121 bits (304), Expect = 9e-32 Identities = 53/54 (98%), Positives = 53/54 (98%) Frame = -1 Query: 322 YTKLENVGTEDYFCRFEYKAATGGFTPDRVAVYCKCEMPYNPDDLMVQCEECKD 161 YTKLENVGTEDYFCRFEYKAATGGFTPDRVAVYCKCEMPYNPDDLMVQCE CKD Sbjct: 108 YTKLENVGTEDYFCRFEYKAATGGFTPDRVAVYCKCEMPYNPDDLMVQCEACKD 161 >dbj|GAV72163.1| PHD domain-containing protein/BAH domain-containing protein [Cephalotus follicularis] Length = 216 Score = 121 bits (303), Expect = 9e-32 Identities = 53/54 (98%), Positives = 53/54 (98%) Frame = -1 Query: 322 YTKLENVGTEDYFCRFEYKAATGGFTPDRVAVYCKCEMPYNPDDLMVQCEECKD 161 YTKLENVGTEDYFCRFEYKAATGGFTPDRVAVYCKCEMPYNPDDLMVQCE CKD Sbjct: 108 YTKLENVGTEDYFCRFEYKAATGGFTPDRVAVYCKCEMPYNPDDLMVQCEGCKD 161 >gb|PKU60016.1| PHD finger protein ALFIN-LIKE 3 [Dendrobium catenatum] Length = 235 Score = 121 bits (304), Expect = 1e-31 Identities = 53/54 (98%), Positives = 53/54 (98%) Frame = -1 Query: 322 YTKLENVGTEDYFCRFEYKAATGGFTPDRVAVYCKCEMPYNPDDLMVQCEECKD 161 YTKLENVGTEDYFCRFEYKAATGGFTPDRVAVYCKCEMPYNPDDLMVQCE CKD Sbjct: 108 YTKLENVGTEDYFCRFEYKAATGGFTPDRVAVYCKCEMPYNPDDLMVQCEACKD 161 >ref|XP_020672829.1| chromatin remodeling protein EBS-like isoform X3 [Dendrobium catenatum] Length = 197 Score = 120 bits (301), Expect = 1e-31 Identities = 52/54 (96%), Positives = 53/54 (98%) Frame = -1 Query: 322 YTKLENVGTEDYFCRFEYKAATGGFTPDRVAVYCKCEMPYNPDDLMVQCEECKD 161 YTKLENVGTEDYFCRFEYKA+TGGFTPDRVAVYCKCEMPYNPDDLMVQCE CKD Sbjct: 89 YTKLENVGTEDYFCRFEYKASTGGFTPDRVAVYCKCEMPYNPDDLMVQCEACKD 142 >ref|XP_023891828.1| chromatin remodeling protein EBS isoform X2 [Quercus suber] Length = 161 Score = 119 bits (298), Expect = 1e-31 Identities = 52/54 (96%), Positives = 52/54 (96%) Frame = -1 Query: 322 YTKLENVGTEDYFCRFEYKAATGGFTPDRVAVYCKCEMPYNPDDLMVQCEECKD 161 YTKLENVG EDYFCRFEYKAATGGFTPDRVAVYCKCEMPYNPDDLMVQCE CKD Sbjct: 108 YTKLENVGAEDYFCRFEYKAATGGFTPDRVAVYCKCEMPYNPDDLMVQCEGCKD 161 >ref|XP_023891827.1| chromatin remodeling protein EBS isoform X1 [Quercus suber] Length = 162 Score = 119 bits (298), Expect = 1e-31 Identities = 52/54 (96%), Positives = 52/54 (96%) Frame = -1 Query: 322 YTKLENVGTEDYFCRFEYKAATGGFTPDRVAVYCKCEMPYNPDDLMVQCEECKD 161 YTKLENVG EDYFCRFEYKAATGGFTPDRVAVYCKCEMPYNPDDLMVQCE CKD Sbjct: 108 YTKLENVGAEDYFCRFEYKAATGGFTPDRVAVYCKCEMPYNPDDLMVQCEGCKD 161 >gb|OMO88861.1| hypothetical protein CCACVL1_08160 [Corchorus capsularis] Length = 162 Score = 119 bits (298), Expect = 1e-31 Identities = 52/54 (96%), Positives = 52/54 (96%) Frame = -1 Query: 322 YTKLENVGTEDYFCRFEYKAATGGFTPDRVAVYCKCEMPYNPDDLMVQCEECKD 161 YTKLENVG EDYFCRFEYKAATGGFTPDRVAVYCKCEMPYNPDDLMVQCE CKD Sbjct: 108 YTKLENVGAEDYFCRFEYKAATGGFTPDRVAVYCKCEMPYNPDDLMVQCEGCKD 161 >gb|OAY83855.1| BAH and coiled-coil domain-containing protein 1 [Ananas comosus] Length = 162 Score = 119 bits (298), Expect = 1e-31 Identities = 52/54 (96%), Positives = 52/54 (96%) Frame = -1 Query: 322 YTKLENVGTEDYFCRFEYKAATGGFTPDRVAVYCKCEMPYNPDDLMVQCEECKD 161 YTKLENVG EDYFCRFEYKAATGGFTPDRVAVYCKCEMPYNPDDLMVQCE CKD Sbjct: 108 YTKLENVGAEDYFCRFEYKAATGGFTPDRVAVYCKCEMPYNPDDLMVQCEGCKD 161 >ref|XP_020270864.1| chromatin remodeling protein EBS-like [Asparagus officinalis] gb|ONK78985.1| uncharacterized protein A4U43_C01F1690 [Asparagus officinalis] Length = 214 Score = 120 bits (302), Expect = 1e-31 Identities = 52/54 (96%), Positives = 53/54 (98%) Frame = -1 Query: 322 YTKLENVGTEDYFCRFEYKAATGGFTPDRVAVYCKCEMPYNPDDLMVQCEECKD 161 YTKLENVG EDYFCRFEYKAATGGFTPDRVAVYCKCEMPYNPDDLMVQC+ECKD Sbjct: 108 YTKLENVGAEDYFCRFEYKAATGGFTPDRVAVYCKCEMPYNPDDLMVQCDECKD 161 >gb|KDO54281.1| hypothetical protein CISIN_1g027093mg [Citrus sinensis] Length = 164 Score = 119 bits (298), Expect = 1e-31 Identities = 52/54 (96%), Positives = 52/54 (96%) Frame = -1 Query: 322 YTKLENVGTEDYFCRFEYKAATGGFTPDRVAVYCKCEMPYNPDDLMVQCEECKD 161 YTKLENVG EDYFCRFEYKAATGGFTPDRVAVYCKCEMPYNPDDLMVQCE CKD Sbjct: 108 YTKLENVGAEDYFCRFEYKAATGGFTPDRVAVYCKCEMPYNPDDLMVQCEGCKD 161 >gb|PIA50568.1| hypothetical protein AQUCO_01200033v1 [Aquilegia coerulea] Length = 138 Score = 118 bits (295), Expect = 2e-31 Identities = 51/54 (94%), Positives = 52/54 (96%) Frame = -1 Query: 322 YTKLENVGTEDYFCRFEYKAATGGFTPDRVAVYCKCEMPYNPDDLMVQCEECKD 161 YTKLENVG EDYFCRFEYKAATGGFTPDRVAVYCKCEMPYNPDDLMVQC+ CKD Sbjct: 39 YTKLENVGAEDYFCRFEYKAATGGFTPDRVAVYCKCEMPYNPDDLMVQCDGCKD 92