BLASTX nr result
ID: Chrysanthemum22_contig00026472
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00026472 (385 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_016173868.1| uncharacterized protein LOC107616422 [Arachi... 54 8e-06 >ref|XP_016173868.1| uncharacterized protein LOC107616422 [Arachis ipaensis] Length = 301 Score = 53.9 bits (128), Expect = 8e-06 Identities = 26/109 (23%), Positives = 52/109 (47%) Frame = -2 Query: 327 EHEVVRAITKDFKALFCGEKTQWHQLDEDLVEIFYKSFQDRYQYEDNVDPETARHVWEER 148 +H V R ITKD + +W ++ + +K F +++++ N D AR VW + Sbjct: 129 DHTVTRDITKDLLSRMPSPAPRWQDYCPNMKDELFKDFLEKHEFASNYDKAMARTVWNKT 188 Query: 147 AKIRFGGLWALVRKNCKKKTNSTNPAEWRVACPEFVTKEDWDGILASWM 1 R+ + K+ NST+ A+ + P+ + + W+G++ W+ Sbjct: 189 MHDRYPDILKRAMDRAFKEANSTSIADIKGHGPKAMKVDVWNGLVDHWL 237