BLASTX nr result
ID: Chrysanthemum22_contig00026278
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00026278 (384 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021976894.1| galactinol synthase 2-like isoform X1 [Helia... 73 1e-12 ref|XP_021976893.1| galactinol synthase 2-like [Helianthus annuu... 73 2e-12 ref|XP_023762669.1| galactinol synthase 2-like [Lactuca sativa] ... 61 2e-08 ref|XP_021997731.1| galactinol synthase 2-like [Helianthus annuu... 58 3e-07 >ref|XP_021976894.1| galactinol synthase 2-like isoform X1 [Helianthus annuus] ref|XP_021976895.1| galactinol synthase 2-like isoform X2 [Helianthus annuus] gb|OTG17985.1| putative galactinol synthase 2 [Helianthus annuus] Length = 339 Score = 73.2 bits (178), Expect = 1e-12 Identities = 34/48 (70%), Positives = 38/48 (79%), Gaps = 2/48 (4%) Frame = -3 Query: 382 WWDIYNDESLDYWRIRGDSM--PLMVLDKPTPVVSKRGSPYVTAPSAA 245 WW+IYNDE+LDYWRI G SM L +DKPTPVVSK G Y+TAPSAA Sbjct: 292 WWEIYNDETLDYWRICGHSMGAQLTAVDKPTPVVSKSGRRYITAPSAA 339 >ref|XP_021976893.1| galactinol synthase 2-like [Helianthus annuus] gb|OTG17984.1| putative galactinol synthase 4 [Helianthus annuus] Length = 339 Score = 72.8 bits (177), Expect = 2e-12 Identities = 34/48 (70%), Positives = 38/48 (79%), Gaps = 2/48 (4%) Frame = -3 Query: 382 WWDIYNDESLDYWRIRGDSMPLMV--LDKPTPVVSKRGSPYVTAPSAA 245 WW+IYNDE+LDYWRI G SM V +DKPTPVVSK G Y+TAPSAA Sbjct: 292 WWEIYNDETLDYWRICGHSMGAQVTAVDKPTPVVSKSGRRYITAPSAA 339 >ref|XP_023762669.1| galactinol synthase 2-like [Lactuca sativa] gb|PLY86347.1| hypothetical protein LSAT_8X23120 [Lactuca sativa] Length = 339 Score = 61.2 bits (147), Expect = 2e-08 Identities = 33/51 (64%), Positives = 37/51 (72%), Gaps = 5/51 (9%) Frame = -3 Query: 382 WWDIYNDESLDYWRIRGDS----MPLMVLDKPTPVVSKRGSP-YVTAPSAA 245 WWDIYNDESLDY + GDS LM DKPTP V+KRG P +V+APSAA Sbjct: 291 WWDIYNDESLDY--VHGDSKVTTTHLMAADKPTPPVTKRGCPLFVSAPSAA 339 >ref|XP_021997731.1| galactinol synthase 2-like [Helianthus annuus] gb|OTG04983.1| putative glycosyl transferase, family 8, nucleotide-diphospho-sugar transferase [Helianthus annuus] Length = 329 Score = 58.2 bits (139), Expect = 3e-07 Identities = 27/48 (56%), Positives = 35/48 (72%), Gaps = 2/48 (4%) Frame = -3 Query: 382 WWDIYNDESLDYWRIRGDSM--PLMVLDKPTPVVSKRGSPYVTAPSAA 245 WW+IYNDE+LDYW+ G SM L +D+PT V++ GS V+APSAA Sbjct: 282 WWEIYNDETLDYWKSCGQSMGTQLTAVDEPTLAVTRSGSRCVSAPSAA 329