BLASTX nr result
ID: Chrysanthemum22_contig00026181
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00026181 (399 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OTG29841.1| hypothetical protein HannXRQ_Chr04g0126571 [Helia... 55 1e-06 >gb|OTG29841.1| hypothetical protein HannXRQ_Chr04g0126571 [Helianthus annuus] Length = 161 Score = 54.7 bits (130), Expect = 1e-06 Identities = 29/45 (64%), Positives = 33/45 (73%) Frame = +1 Query: 106 IVVFVSSLSLIPFRFYSFGLKFTNIVDANDRHYIFLLCNVILVFL 240 +VVF SLS PFRF SFG FTN +D D++YIFLLCN IL FL Sbjct: 1 MVVFAYSLSH-PFRFQSFGSLFTNFLDIIDKNYIFLLCNCILFFL 44