BLASTX nr result
ID: Chrysanthemum22_contig00026123
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00026123 (350 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020519344.1| cationic amino acid transporter 9, chloropla... 55 2e-06 ref|XP_006837350.1| cationic amino acid transporter 9, chloropla... 55 2e-06 ref|XP_007052288.1| PREDICTED: cationic amino acid transporter 9... 54 9e-06 ref|XP_022030123.1| cationic amino acid transporter 9, chloropla... 54 9e-06 >ref|XP_020519344.1| cationic amino acid transporter 9, chloroplastic isoform X2 [Amborella trichopoda] Length = 452 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/55 (45%), Positives = 37/55 (67%) Frame = -3 Query: 213 LYCLIGFLPLVIFFSLMHILCYNLVQMDPPGFCCPCVPIVPALCILVSIFLFDQV 49 L+ L+ + +IF + +H + V DPPGF CP VP+VPA+CI ++IFLF Q+ Sbjct: 354 LFSLVAIVIAMIFIAALH---FRQVYADPPGFSCPGVPLVPAVCIFLNIFLFAQL 405 >ref|XP_006837350.1| cationic amino acid transporter 9, chloroplastic isoform X1 [Amborella trichopoda] gb|ERN00204.1| hypothetical protein AMTR_s00111p00096770 [Amborella trichopoda] Length = 563 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/55 (45%), Positives = 37/55 (67%) Frame = -3 Query: 213 LYCLIGFLPLVIFFSLMHILCYNLVQMDPPGFCCPCVPIVPALCILVSIFLFDQV 49 L+ L+ + +IF + +H + V DPPGF CP VP+VPA+CI ++IFLF Q+ Sbjct: 465 LFSLVAIVIAMIFIAALH---FRQVYADPPGFSCPGVPLVPAVCIFLNIFLFAQL 516 >ref|XP_007052288.1| PREDICTED: cationic amino acid transporter 9, chloroplastic [Theobroma cacao] gb|EOX96445.1| Cationic amino acid transporter [Theobroma cacao] Length = 564 Score = 53.5 bits (127), Expect = 9e-06 Identities = 22/36 (61%), Positives = 26/36 (72%) Frame = -3 Query: 156 LCYNLVQMDPPGFCCPCVPIVPALCILVSIFLFDQV 49 LCY DPPGF CP VPIVP++CI +IFLF Q+ Sbjct: 483 LCYRQAYSDPPGFSCPVVPIVPSVCIFFNIFLFAQL 518 >ref|XP_022030123.1| cationic amino acid transporter 9, chloroplastic-like [Helianthus annuus] gb|OTG33044.1| putative amino acid/polyamine transporter I, Cationic amino acid transporter [Helianthus annuus] Length = 566 Score = 53.5 bits (127), Expect = 9e-06 Identities = 25/48 (52%), Positives = 32/48 (66%) Frame = -3 Query: 192 LPLVIFFSLMHILCYNLVQMDPPGFCCPCVPIVPALCILVSIFLFDQV 49 +P++I L + QMD PGF CP VP+VPALCI V+IFLF Q+ Sbjct: 472 IPIIIAILATAALRFRQEQMDLPGFSCPWVPMVPALCIFVNIFLFAQL 519