BLASTX nr result
ID: Chrysanthemum22_contig00026104
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00026104 (432 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAO87435.1| putative membrane protein [Burkholderia sp. RPE6... 193 9e-60 dbj|BAO86772.1| putative membrane protein [Burkholderia sp. RPE6... 191 5e-59 dbj|BAG46932.1| cell wall-associated hydrolase [Burkholderia mul... 189 3e-58 gb|KNH03717.1| Cell wall-associated hydrolase [Candidatus Burkho... 188 1e-57 gb|ABM53543.1| conserved hypothetical protein [uncultured beta p... 171 9e-53 gb|ELY20074.1| hypothetical protein HALTITAN_3299 [Halomonas tit... 167 2e-50 emb|CRY95131.1| hypothetical protein [uncultured prokaryote] 151 4e-44 emb|CWM94285.1| Cell wall-associated hydrolase [Neisseria mening... 144 1e-40 gb|EDU61869.1| hypothetical protein PROSTU_00109 [Providencia st... 143 2e-40 emb|CWP67249.1| Cell wall-associated hydrolase [Neisseria mening... 144 2e-40 emb|CWO70233.1| Cell wall-associated hydrolase [Neisseria mening... 142 5e-40 emb|CWS15795.1| Cell wall-associated hydrolase [Neisseria mening... 141 1e-39 emb|CWT82569.1| Cell wall-associated hydrolase [Neisseria mening... 141 1e-39 emb|CKL43271.1| Cell wall-associated hydrolase [Neisseria mening... 141 2e-39 gb|KTC66800.1| hypothetical protein Lbir_3102 [Legionella birmin... 137 3e-39 gb|ELL01666.1| hypothetical protein NM4119_1450, partial [Neisse... 138 4e-39 emb|CWO51373.1| Cell wall-associated hydrolase [Neisseria mening... 138 2e-38 gb|EJU56892.1| cell wall-associated hydrolase [Neisseria meningi... 138 2e-38 emb|CWT43744.1| Cell wall-associated hydrolase [Neisseria mening... 138 2e-38 emb|CWO79403.1| Cell wall-associated hydrolase [Neisseria mening... 138 2e-38 >dbj|BAO87435.1| putative membrane protein [Burkholderia sp. RPE67] dbj|BAO87487.1| putative membrane protein [Burkholderia sp. RPE67] dbj|BAO87598.1| putative membrane protein [Burkholderia sp. RPE67] Length = 234 Score = 193 bits (491), Expect = 9e-60 Identities = 93/119 (78%), Positives = 97/119 (81%) Frame = -1 Query: 432 HTEPPDHXXXXXXXXXXXXXXXSTLMPLHYRHDFRP*LAYLRTPPLRFGRRPPQSNCLPC 253 HTEPPDH STLMPLHY+HDFRP LAYLRTPPLRFGRRPPQSNCLPC Sbjct: 116 HTEPPDHYDLLSHLLDLSVSQLSTLMPLHYQHDFRPYLAYLRTPPLRFGRRPPQSNCLPC 175 Query: 252 TVPDPDYGPRLEPQTHQGGISTSAPCELASALQSLPPILHRSVQSPMQSYSKGSWGLSV 76 TVPDPD+GPRLEPQT+QGGIS +AP LAS SLPPILHRSVQSPMQSYSKGSWGLSV Sbjct: 176 TVPDPDHGPRLEPQTNQGGISRTAPPRLASWFHSLPPILHRSVQSPMQSYSKGSWGLSV 234 >dbj|BAO86772.1| putative membrane protein [Burkholderia sp. RPE67] dbj|BAO88159.1| putative membrane protein [Burkholderia sp. RPE67] dbj|BAO90886.1| putative membrane protein [Burkholderia sp. RPE67] Length = 234 Score = 191 bits (486), Expect = 5e-59 Identities = 92/119 (77%), Positives = 96/119 (80%) Frame = -1 Query: 432 HTEPPDHXXXXXXXXXXXXXXXSTLMPLHYRHDFRP*LAYLRTPPLRFGRRPPQSNCLPC 253 HTEPPDH STLMPLHY+HDFRP LAYLRTPPL FGRRPPQSNCLPC Sbjct: 116 HTEPPDHYDLLSHLLDLSVSQLSTLMPLHYQHDFRPYLAYLRTPPLHFGRRPPQSNCLPC 175 Query: 252 TVPDPDYGPRLEPQTHQGGISTSAPCELASALQSLPPILHRSVQSPMQSYSKGSWGLSV 76 TVPDPD+GPRLEPQT+QGGIS +AP LAS SLPPILHRSVQSPMQSYSKGSWGLSV Sbjct: 176 TVPDPDHGPRLEPQTNQGGISRTAPPRLASWFHSLPPILHRSVQSPMQSYSKGSWGLSV 234 >dbj|BAG46932.1| cell wall-associated hydrolase [Burkholderia multivorans ATCC 17616] Length = 234 Score = 189 bits (481), Expect = 3e-58 Identities = 91/119 (76%), Positives = 96/119 (80%) Frame = -1 Query: 432 HTEPPDHXXXXXXXXXXXXXXXSTLMPLHYRHDFRP*LAYLRTPPLRFGRRPPQSNCLPC 253 HTEPPDH STLMPLHY+HDFRP LAYLRTPPL FGRRPPQSNCLPC Sbjct: 116 HTEPPDHYDLLSHLLDLSVSQLSTLMPLHYQHDFRPYLAYLRTPPLPFGRRPPQSNCLPC 175 Query: 252 TVPDPDYGPRLEPQTHQGGISTSAPCELASALQSLPPILHRSVQSPMQSYSKGSWGLSV 76 TVPDPD+GPRLEPQT+QGGIS +AP +LA SLPPILHRSVQSPMQSYSKGSWGLSV Sbjct: 176 TVPDPDHGPRLEPQTNQGGISRTAPPKLAFRFHSLPPILHRSVQSPMQSYSKGSWGLSV 234 >gb|KNH03717.1| Cell wall-associated hydrolase [Candidatus Burkholderia brachyanthoides] Length = 234 Score = 188 bits (477), Expect = 1e-57 Identities = 90/119 (75%), Positives = 96/119 (80%) Frame = -1 Query: 432 HTEPPDHXXXXXXXXXXXXXXXSTLMPLHYRHDFRP*LAYLRTPPLRFGRRPPQSNCLPC 253 HTEPPDH STLMPLHY+HDFRP LAYL TPPLRFGRRPPQSNCLPC Sbjct: 116 HTEPPDHYDLLSHLLDLSVSQLSTLMPLHYQHDFRPYLAYLCTPPLRFGRRPPQSNCLPC 175 Query: 252 TVPDPDYGPRLEPQTHQGGISTSAPCELASALQSLPPILHRSVQSPMQSYSKGSWGLSV 76 TVPDPD+GPRLEPQT+QGGIS +AP LAS SLPPILH+SVQ+PMQSYSKGSWGLSV Sbjct: 176 TVPDPDHGPRLEPQTNQGGISRTAPPRLASWFHSLPPILHKSVQNPMQSYSKGSWGLSV 234 >gb|ABM53543.1| conserved hypothetical protein [uncultured beta proteobacterium CBNPD1 BAC clone 578] Length = 114 Score = 171 bits (434), Expect = 9e-53 Identities = 85/110 (77%), Positives = 91/110 (82%) Frame = -3 Query: 430 YRTTGSLCPTFVPARLVSLAVKHAYAIALSSRFXXXXXXXXXXXXTLWEETAPVKLPTMH 251 YRTTGSL P+F+PARLVSLAVKHAYA ALS+RF TLWEETAPVKLPT+H Sbjct: 5 YRTTGSLSPSFLPARLVSLAVKHAYAYALSARFPTVPSVPSNSSVTLWEETAPVKLPTIH 64 Query: 250 CPRSGLRAQVRTSNTPGWYFNVGSMRTGVRTSKPPTYPTQIGSKSNAKLQ 101 CP+ G RA+VRTSNTPGWYFNVGSMRT VRTSKPPTYPTQI SKSN KLQ Sbjct: 65 CPQPGSRAKVRTSNTPGWYFNVGSMRTSVRTSKPPTYPTQICSKSNVKLQ 114 >gb|ELY20074.1| hypothetical protein HALTITAN_3299 [Halomonas titanicae BH1] Length = 163 Score = 167 bits (423), Expect = 2e-50 Identities = 87/131 (66%), Positives = 94/131 (71%) Frame = -2 Query: 431 IQNHRITMSYFRTCSTCQSRSQARLCHCTIVTISDRN*RTFELLRYALGGDRPSQTAYHA 252 IQNHRIT + FRTCSTC SRSQA LC CT T+SDR TF LLRY+LGGDRPSQT +H Sbjct: 31 IQNHRITRTCFRTCSTCLSRSQAPLCSCTQCTMSDRAEGTFVLLRYSLGGDRPSQTTHHT 90 Query: 251 LSPIRITGPG*NLKHTRVVFQRRLHANWRPHFKASHLSYTDRFKVQCKATVKVHGVFPSS 72 LS IRIT N R+VFQ L NWRP FKAS LSYT VQC+A VKVHGVFPSS Sbjct: 91 LSSIRITDLSENANDARLVFQGWLPPNWRPEFKASQLSYTGNISVQCEAIVKVHGVFPSS 150 Query: 71 RGEIASSQTLQ 39 RG ASS+ Q Sbjct: 151 RGYTASSRRFQ 161 >emb|CRY95131.1| hypothetical protein [uncultured prokaryote] Length = 154 Score = 151 bits (381), Expect = 4e-44 Identities = 77/119 (64%), Positives = 84/119 (70%) Frame = -1 Query: 432 HTEPPDHXXXXXXXXXXXXXXXSTLMPLHYRHDFRP*LAYLRTPPLRFGRRPPQSNCLPC 253 H+ PPDH STL+PLHY+HDFRP LAYLRTPPL F RRPPQSNCLPC Sbjct: 36 HSVPPDHYDLLSHLLELWLSQSSTLLPLHYQHDFRPYLAYLRTPPLPFRRRPPQSNCLPC 95 Query: 252 TVPDPDYGPRLEPQTHQGGISTSAPCELASALQSLPPILHRSVQSPMQSYSKGSWGLSV 76 TVP+ + LEPQT+QGGIS S P ELA LPPILH+SV S MQS SKGSWGLSV Sbjct: 96 TVPNSVHLSWLEPQTNQGGISRSTPEELALLFLCLPPILHKSVHSSMQSCSKGSWGLSV 154 >emb|CWM94285.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ55632.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP70409.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT55260.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ46117.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ13555.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ36002.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM24872.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM89367.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM29376.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM58488.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ43465.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO88989.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM95535.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR30100.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ33640.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ59206.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM36524.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS69311.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM22624.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP71542.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM59150.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP51019.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM08047.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO07120.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT61805.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM47351.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT94404.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR12276.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN35808.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR65428.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS39952.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM58445.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ35548.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR63221.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ50134.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO61260.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP84864.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR81609.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO15838.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM62696.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ53410.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ41081.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ35446.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR13064.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR93195.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR58618.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN75830.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN92984.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN28987.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN69271.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM82912.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR53819.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP88866.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM23382.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM26625.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ19861.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT62879.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM53098.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT53692.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM83365.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO21529.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN92282.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS58259.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ37187.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS05620.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS03273.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR66185.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ77951.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM54395.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR31800.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS23086.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO96526.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS82264.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ60516.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO11803.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO26530.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP00554.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS13977.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ30750.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM62238.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN86557.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN54402.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ65336.1| Cell wall-associated hydrolase [Neisseria meningitidis] Length = 202 Score = 144 bits (362), Expect = 1e-40 Identities = 70/101 (69%), Positives = 74/101 (73%) Frame = -1 Query: 432 HTEPPDHXXXXXXXXXXXXXXXSTLMPLHYRHDFRP*LAYLRTPPLRFGRRPPQSNCLPC 253 HTEPPDH S L+PLHY+ DFRP L LRTPPLRFGRRPPQSNCLPC Sbjct: 102 HTEPPDHYVLLSHLLDLSVSQLSYLLPLHYQSDFRPDLGNLRTPPLRFGRRPPQSNCLPC 161 Query: 252 TVPDPDYGPRLEPQTHQGGISTSAPCELASALQSLPPILHR 130 TVPDPD G RLEPQ HQGGIS +AP LAS LQSLPPILH+ Sbjct: 162 TVPDPDDGSRLEPQRHQGGISRTAPQRLASLLQSLPPILHK 202 >gb|EDU61869.1| hypothetical protein PROSTU_00109 [Providencia stuartii ATCC 25827] Length = 189 Score = 143 bits (360), Expect = 2e-40 Identities = 77/112 (68%), Positives = 80/112 (71%) Frame = -1 Query: 339 HDFRP*LAYLRTPPLRFGRRPPQSNCLPCTVPDPDYGPRLEPQTHQGGISTSAPCELASA 160 HD RP LA LR PPLRFGRRPPQSN P TV PDYG LE QT +GGIS APC LAS Sbjct: 35 HDVRPCLANLRAPPLRFGRRPPQSNYPPDTVRTPDYGATLEHQTLKGGISRLAPCRLAST 94 Query: 159 LQSLPPILHRSVQSPMQSYSKGSWGLSV*PRGDCIITNTSTSLSLGRRQCGH 4 LQSLPPILH Q + SYSKGS GLSV PR CI T +S SLSLG RQ GH Sbjct: 95 LQSLPPILHIKAQCSVSSYSKGSRGLSVLPRVHCIFTASSISLSLGWRQPGH 146 >emb|CWP67249.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT59615.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS18382.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR45378.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ16501.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN87478.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM92680.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN67326.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP45878.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP38468.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ30366.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO45593.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT45368.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM35122.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ61517.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR11989.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT68492.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP89907.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM28216.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ55809.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM90768.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ97896.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS39350.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO06049.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN51672.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM72155.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO27120.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN29951.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ78977.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ62225.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS89623.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM32710.1| Cell wall-associated hydrolase [Neisseria meningitidis] Length = 216 Score = 144 bits (362), Expect = 2e-40 Identities = 70/101 (69%), Positives = 74/101 (73%) Frame = -1 Query: 432 HTEPPDHXXXXXXXXXXXXXXXSTLMPLHYRHDFRP*LAYLRTPPLRFGRRPPQSNCLPC 253 HTEPPDH S L+PLHY+ DFRP L LRTPPLRFGRRPPQSNCLPC Sbjct: 116 HTEPPDHYVLLSHLLDLSVSQLSYLLPLHYQSDFRPDLGNLRTPPLRFGRRPPQSNCLPC 175 Query: 252 TVPDPDYGPRLEPQTHQGGISTSAPCELASALQSLPPILHR 130 TVPDPD G RLEPQ HQGGIS +AP LAS LQSLPPILH+ Sbjct: 176 TVPDPDDGSRLEPQRHQGGISRTAPQRLASLLQSLPPILHK 216 >emb|CWO70233.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS61864.1| Cell wall-associated hydrolase [Neisseria meningitidis] Length = 202 Score = 142 bits (358), Expect = 5e-40 Identities = 69/101 (68%), Positives = 73/101 (72%) Frame = -1 Query: 432 HTEPPDHXXXXXXXXXXXXXXXSTLMPLHYRHDFRP*LAYLRTPPLRFGRRPPQSNCLPC 253 HTEPPDH S L+PLHY+ DFRP L LRTPPLRFGRRPPQSNCLPC Sbjct: 102 HTEPPDHYVLLSHLLDLSVSQLSYLLPLHYQSDFRPDLGNLRTPPLRFGRRPPQSNCLPC 161 Query: 252 TVPDPDYGPRLEPQTHQGGISTSAPCELASALQSLPPILHR 130 TVPDPD G RLEPQ HQGGIS + P LAS LQSLPPILH+ Sbjct: 162 TVPDPDDGSRLEPQRHQGGISRTTPQRLASLLQSLPPILHK 202 >emb|CWS15795.1| Cell wall-associated hydrolase [Neisseria meningitidis] Length = 202 Score = 141 bits (355), Expect = 1e-39 Identities = 69/101 (68%), Positives = 73/101 (72%) Frame = -1 Query: 432 HTEPPDHXXXXXXXXXXXXXXXSTLMPLHYRHDFRP*LAYLRTPPLRFGRRPPQSNCLPC 253 HTEPPDH S L+PLHY+ DFRP L LRTPPLRFGRRPPQSNCLPC Sbjct: 102 HTEPPDHYVLLSHLLDLSVSQLSYLLPLHYQSDFRPDLGNLRTPPLRFGRRPPQSNCLPC 161 Query: 252 TVPDPDYGPRLEPQTHQGGISTSAPCELASALQSLPPILHR 130 TVPDPD G RLEPQ HQGGIS +AP LAS L SLPPILH+ Sbjct: 162 TVPDPDDGSRLEPQRHQGGISRTAPQRLASLLLSLPPILHK 202 >emb|CWT82569.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP44468.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT59196.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS83033.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP46906.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP27798.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN98251.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ04956.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT93866.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP96790.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT92957.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR69071.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN70881.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN17584.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ42038.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP73355.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO79925.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR78282.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS37293.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO16958.1| Cell wall-associated hydrolase [Neisseria meningitidis] Length = 202 Score = 141 bits (355), Expect = 1e-39 Identities = 69/101 (68%), Positives = 73/101 (72%) Frame = -1 Query: 432 HTEPPDHXXXXXXXXXXXXXXXSTLMPLHYRHDFRP*LAYLRTPPLRFGRRPPQSNCLPC 253 HTEPPDH S L+PLHY+ DFRP L LRTPPLRFGRRPPQSNCLPC Sbjct: 102 HTEPPDHYVLLSHLLDLSVSQLSYLLPLHYQSDFRPDLGNLRTPPLRFGRRPPQSNCLPC 161 Query: 252 TVPDPDYGPRLEPQTHQGGISTSAPCELASALQSLPPILHR 130 TVPDPD G LEPQ HQGGIS +AP LAS LQSLPPILH+ Sbjct: 162 TVPDPDDGSGLEPQRHQGGISRTAPQRLASLLQSLPPILHK 202 >emb|CKL43271.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR65376.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO43812.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS31701.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR93279.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT88142.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP62169.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO09337.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS97823.1| Cell wall-associated hydrolase [Neisseria meningitidis] Length = 216 Score = 141 bits (355), Expect = 2e-39 Identities = 69/101 (68%), Positives = 73/101 (72%) Frame = -1 Query: 432 HTEPPDHXXXXXXXXXXXXXXXSTLMPLHYRHDFRP*LAYLRTPPLRFGRRPPQSNCLPC 253 HTEPPDH S L+PLHY+ DFRP L LRTPPLRFGRRPPQSNCLPC Sbjct: 116 HTEPPDHYVLLSHLLDLSVSQLSYLLPLHYQSDFRPDLGNLRTPPLRFGRRPPQSNCLPC 175 Query: 252 TVPDPDYGPRLEPQTHQGGISTSAPCELASALQSLPPILHR 130 TVPDPD G LEPQ HQGGIS +AP LAS LQSLPPILH+ Sbjct: 176 TVPDPDDGSGLEPQRHQGGISRTAPQRLASLLQSLPPILHK 216 >gb|KTC66800.1| hypothetical protein Lbir_3102 [Legionella birminghamensis] gb|KTD49696.1| hypothetical protein Lqui_1907 [Legionella quinlivanii] Length = 107 Score = 137 bits (345), Expect = 3e-39 Identities = 69/91 (75%), Positives = 75/91 (82%) Frame = +3 Query: 159 VRTPVRMEPTLKYHPGVFEVLTWARNPDRGQCMVGSLTGAVSSQSVTEEFEGTLVTVGNR 338 +RTPVRMEPTLKYHP + EVLTW+ +P RGQCMVGSLTGAVSSQ VTEE +GTL TVG+R Sbjct: 1 MRTPVRMEPTLKYHPVIIEVLTWSSHPGRGQCMVGSLTGAVSSQRVTEEHKGTLGTVGHR 60 Query: 339 DDSAMA*ACLTARLTSRAGTKVGHSDPVVLY 431 S A CLTAR T RAGTKVG SDPVVLY Sbjct: 61 TKSVKAKGCLTARRTCRAGTKVGLSDPVVLY 91 >gb|ELL01666.1| hypothetical protein NM4119_1450, partial [Neisseria meningitidis 4119] Length = 156 Score = 138 bits (348), Expect = 4e-39 Identities = 68/101 (67%), Positives = 72/101 (71%) Frame = -1 Query: 432 HTEPPDHXXXXXXXXXXXXXXXSTLMPLHYRHDFRP*LAYLRTPPLRFGRRPPQSNCLPC 253 HTEPPDH S L+PLHY+ DFRP L LRTPPLRFGRRPPQSNCLPC Sbjct: 56 HTEPPDHYVLLSHLLDLSVSQLSYLLPLHYQSDFRPDLGNLRTPPLRFGRRPPQSNCLPC 115 Query: 252 TVPDPDYGPRLEPQTHQGGISTSAPCELASALQSLPPILHR 130 TVPDPD G LEPQ HQGGIS +AP LAS L SLPPILH+ Sbjct: 116 TVPDPDDGSGLEPQRHQGGISRTAPQRLASLLLSLPPILHK 156 >emb|CWO51373.1| Cell wall-associated hydrolase [Neisseria meningitidis] Length = 202 Score = 138 bits (348), Expect = 2e-38 Identities = 68/101 (67%), Positives = 72/101 (71%) Frame = -1 Query: 432 HTEPPDHXXXXXXXXXXXXXXXSTLMPLHYRHDFRP*LAYLRTPPLRFGRRPPQSNCLPC 253 HTEPPDH S L+PLHY+ DFRP L LRTPPLRFGRRPPQSNCLPC Sbjct: 102 HTEPPDHYVLLSHLLDLLVSQLSYLLPLHYQSDFRPDLGNLRTPPLRFGRRPPQSNCLPC 161 Query: 252 TVPDPDYGPRLEPQTHQGGISTSAPCELASALQSLPPILHR 130 TVPDPD G LEPQ HQGGIS +AP LAS L SLPPILH+ Sbjct: 162 TVPDPDDGSGLEPQRHQGGISRTAPQRLASLLLSLPPILHK 202 >gb|EJU56892.1| cell wall-associated hydrolase [Neisseria meningitidis NM140] gb|EJU61973.1| cell wall-associated hydrolase [Neisseria meningitidis NM140] gb|EJU62544.1| cell wall-associated hydrolase [Neisseria meningitidis 69166] gb|ELK74541.1| hypothetical protein NM2006087_0256 [Neisseria meningitidis 2006087] gb|ELL00985.1| hypothetical protein NM12888_1665 [Neisseria meningitidis 12888] emb|CWO33360.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS22460.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT52492.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO87056.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP11771.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR97728.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN57532.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP67952.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM35585.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN41524.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWU00589.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ40111.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT04099.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP26351.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT63701.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS70177.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO22916.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP54997.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS22406.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR45207.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP53785.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP03678.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT87473.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP91498.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN67092.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO96602.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO95311.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT55895.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT13818.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP48902.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS33681.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP78000.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO12897.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS86296.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP20575.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT29169.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP63785.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS84972.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP92574.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP59033.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT49266.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS27719.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM46796.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN46619.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ68119.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO15682.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ08477.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS17962.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP30862.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO42413.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR29661.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO31337.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ04898.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP10150.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM05078.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM12681.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT61744.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN57772.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR90150.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT16329.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR30726.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT07011.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP52443.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN21252.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN45814.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN19844.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ43419.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR10684.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR33680.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO48013.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT37813.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP53477.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP86780.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT58035.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN17637.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN08518.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS23659.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR26094.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT34423.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP99181.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS36926.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM80848.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN88221.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ99732.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO40610.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO11922.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR49944.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR50940.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ80168.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP28080.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS36757.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN29027.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO57148.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS94689.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO86275.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS34667.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN65467.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ62273.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR08251.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT18242.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP36630.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT70851.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ29131.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM14786.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ17869.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP41619.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT32077.1| Cell wall-associated hydrolase [Neisseria meningitidis] Length = 202 Score = 138 bits (348), Expect = 2e-38 Identities = 68/101 (67%), Positives = 72/101 (71%) Frame = -1 Query: 432 HTEPPDHXXXXXXXXXXXXXXXSTLMPLHYRHDFRP*LAYLRTPPLRFGRRPPQSNCLPC 253 HTEPPDH S L+PLHY+ DFRP L LRTPPLRFGRRPPQSNCLPC Sbjct: 102 HTEPPDHYVLLSHLLDLSVSQLSYLLPLHYQSDFRPDLGNLRTPPLRFGRRPPQSNCLPC 161 Query: 252 TVPDPDYGPRLEPQTHQGGISTSAPCELASALQSLPPILHR 130 TVPDPD G LEPQ HQGGIS +AP LAS L SLPPILH+ Sbjct: 162 TVPDPDDGSGLEPQRHQGGISRTAPQRLASLLLSLPPILHK 202 >emb|CWT43744.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ03425.1| Cell wall-associated hydrolase [Neisseria meningitidis] Length = 202 Score = 138 bits (347), Expect = 2e-38 Identities = 68/101 (67%), Positives = 72/101 (71%) Frame = -1 Query: 432 HTEPPDHXXXXXXXXXXXXXXXSTLMPLHYRHDFRP*LAYLRTPPLRFGRRPPQSNCLPC 253 HTEPPDH S L+PLHY+ DFRP L LRTPPLRFGRRPPQSNCLPC Sbjct: 102 HTEPPDHYVLLSHLLDLSVSQLSYLLPLHYQSDFRPDLGNLRTPPLRFGRRPPQSNCLPC 161 Query: 252 TVPDPDYGPRLEPQTHQGGISTSAPCELASALQSLPPILHR 130 TVPDPD LEPQ HQGGIS +AP LAS LQSLPPILH+ Sbjct: 162 TVPDPDDESGLEPQRHQGGISRTAPQRLASLLQSLPPILHK 202 >emb|CWO79403.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS73015.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP48004.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT53749.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP56073.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT45211.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP40556.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS34214.1| Cell wall-associated hydrolase [Neisseria meningitidis] Length = 216 Score = 138 bits (348), Expect = 2e-38 Identities = 68/101 (67%), Positives = 72/101 (71%) Frame = -1 Query: 432 HTEPPDHXXXXXXXXXXXXXXXSTLMPLHYRHDFRP*LAYLRTPPLRFGRRPPQSNCLPC 253 HTEPPDH S L+PLHY+ DFRP L LRTPPLRFGRRPPQSNCLPC Sbjct: 116 HTEPPDHYVLLSHLLDLLVSQLSYLLPLHYQSDFRPDLGNLRTPPLRFGRRPPQSNCLPC 175 Query: 252 TVPDPDYGPRLEPQTHQGGISTSAPCELASALQSLPPILHR 130 TVPDPD G LEPQ HQGGIS +AP LAS L SLPPILH+ Sbjct: 176 TVPDPDDGSGLEPQRHQGGISRTAPQRLASLLLSLPPILHK 216