BLASTX nr result
ID: Chrysanthemum22_contig00025917
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00025917 (569 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_017608926.1| PREDICTED: boron transporter 1-like isoform ... 62 1e-07 ref|XP_010248503.1| PREDICTED: probable boron transporter 2 [Nel... 60 3e-07 gb|KJB39175.1| hypothetical protein B456_007G001500 [Gossypium r... 60 3e-07 gb|KJB39176.1| hypothetical protein B456_007G001500 [Gossypium r... 60 3e-07 gb|PPD70460.1| hypothetical protein GOBAR_DD32662 [Gossypium bar... 60 3e-07 gb|KJB39174.1| hypothetical protein B456_007G001500 [Gossypium r... 60 3e-07 gb|KJB30289.1| hypothetical protein B456_005G135900 [Gossypium r... 60 4e-07 gb|KJB39177.1| hypothetical protein B456_007G001500 [Gossypium r... 60 4e-07 ref|XP_012488354.1| PREDICTED: boron transporter 1-like [Gossypi... 60 4e-07 ref|XP_016741830.1| PREDICTED: probable boron transporter 2 isof... 60 4e-07 ref|XP_012478587.1| PREDICTED: probable boron transporter 2 isof... 60 4e-07 gb|PPR90350.1| hypothetical protein GOBAR_AA30334 [Gossypium bar... 60 4e-07 ref|XP_016741829.1| PREDICTED: probable boron transporter 2 isof... 60 4e-07 ref|XP_012478586.1| PREDICTED: probable boron transporter 2 isof... 60 4e-07 ref|XP_017623081.1| PREDICTED: probable boron transporter 2 isof... 60 4e-07 ref|XP_022736165.1| boron transporter 1-like isoform X1 [Durio z... 60 4e-07 ref|XP_021292535.1| probable boron transporter 2 [Herrania umbra... 60 4e-07 ref|XP_017973464.1| PREDICTED: probable boron transporter 2 [The... 60 4e-07 gb|PON59650.1| Bicarbonate transporter [Trema orientalis] 60 4e-07 gb|EXB75660.1| putative boron transporter 2 [Morus notabilis] 59 7e-07 >ref|XP_017608926.1| PREDICTED: boron transporter 1-like isoform X1 [Gossypium arboreum] ref|XP_017608928.1| PREDICTED: boron transporter 1-like isoform X1 [Gossypium arboreum] Length = 737 Score = 61.6 bits (148), Expect = 1e-07 Identities = 32/51 (62%), Positives = 36/51 (70%) Frame = +2 Query: 2 ASQLAQQSEFNLKKPPSYHYDLLLLGFLVSEPSWVFIHISNQCIFKFCCMF 154 ASQLAQQ EFNL+KPPS+HYDLLLLGFLV P F ++C F MF Sbjct: 315 ASQLAQQKEFNLRKPPSFHYDLLLLGFLVPVP---FFLCFSKCTSVFTLMF 362 >ref|XP_010248503.1| PREDICTED: probable boron transporter 2 [Nelumbo nucifera] Length = 720 Score = 60.5 bits (145), Expect = 3e-07 Identities = 32/44 (72%), Positives = 33/44 (75%) Frame = +2 Query: 2 ASQLAQQSEFNLKKPPSYHYDLLLLGFLVSEPSWVFIHISNQCI 133 ASQLAQQ EFNLKKPPSYHYDLLLLGFLV + I SN I Sbjct: 315 ASQLAQQKEFNLKKPPSYHYDLLLLGFLVIVCGLIGIPPSNGVI 358 >gb|KJB39175.1| hypothetical protein B456_007G001500 [Gossypium raimondii] Length = 528 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +2 Query: 2 ASQLAQQSEFNLKKPPSYHYDLLLLGFLV 88 ASQLAQQ EFNLKKPPSYHYDLLLLGFLV Sbjct: 143 ASQLAQQKEFNLKKPPSYHYDLLLLGFLV 171 >gb|KJB39176.1| hypothetical protein B456_007G001500 [Gossypium raimondii] Length = 536 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +2 Query: 2 ASQLAQQSEFNLKKPPSYHYDLLLLGFLV 88 ASQLAQQ EFNLKKPPSYHYDLLLLGFLV Sbjct: 151 ASQLAQQKEFNLKKPPSYHYDLLLLGFLV 179 >gb|PPD70460.1| hypothetical protein GOBAR_DD32662 [Gossypium barbadense] Length = 541 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +2 Query: 2 ASQLAQQSEFNLKKPPSYHYDLLLLGFLV 88 ASQLAQQ EFNLKKPPSYHYDLLLLGFLV Sbjct: 315 ASQLAQQKEFNLKKPPSYHYDLLLLGFLV 343 >gb|KJB39174.1| hypothetical protein B456_007G001500 [Gossypium raimondii] Length = 599 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +2 Query: 2 ASQLAQQSEFNLKKPPSYHYDLLLLGFLV 88 ASQLAQQ EFNLKKPPSYHYDLLLLGFLV Sbjct: 214 ASQLAQQKEFNLKKPPSYHYDLLLLGFLV 242 >gb|KJB30289.1| hypothetical protein B456_005G135900 [Gossypium raimondii] Length = 637 Score = 60.1 bits (144), Expect = 4e-07 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +2 Query: 2 ASQLAQQSEFNLKKPPSYHYDLLLLGFLV 88 ASQLAQQ EFNLKKPPSYHYDLLLLGFLV Sbjct: 315 ASQLAQQKEFNLKKPPSYHYDLLLLGFLV 343 >gb|KJB39177.1| hypothetical protein B456_007G001500 [Gossypium raimondii] Length = 692 Score = 60.1 bits (144), Expect = 4e-07 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +2 Query: 2 ASQLAQQSEFNLKKPPSYHYDLLLLGFLV 88 ASQLAQQ EFNLKKPPSYHYDLLLLGFLV Sbjct: 307 ASQLAQQKEFNLKKPPSYHYDLLLLGFLV 335 >ref|XP_012488354.1| PREDICTED: boron transporter 1-like [Gossypium raimondii] gb|KJB39178.1| hypothetical protein B456_007G001500 [Gossypium raimondii] gb|KJB39179.1| hypothetical protein B456_007G001500 [Gossypium raimondii] Length = 700 Score = 60.1 bits (144), Expect = 4e-07 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +2 Query: 2 ASQLAQQSEFNLKKPPSYHYDLLLLGFLV 88 ASQLAQQ EFNLKKPPSYHYDLLLLGFLV Sbjct: 315 ASQLAQQKEFNLKKPPSYHYDLLLLGFLV 343 >ref|XP_016741830.1| PREDICTED: probable boron transporter 2 isoform X2 [Gossypium hirsutum] Length = 702 Score = 60.1 bits (144), Expect = 4e-07 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +2 Query: 2 ASQLAQQSEFNLKKPPSYHYDLLLLGFLV 88 ASQLAQQ EFNLKKPPSYHYDLLLLGFLV Sbjct: 302 ASQLAQQKEFNLKKPPSYHYDLLLLGFLV 330 >ref|XP_012478587.1| PREDICTED: probable boron transporter 2 isoform X2 [Gossypium raimondii] Length = 702 Score = 60.1 bits (144), Expect = 4e-07 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +2 Query: 2 ASQLAQQSEFNLKKPPSYHYDLLLLGFLV 88 ASQLAQQ EFNLKKPPSYHYDLLLLGFLV Sbjct: 302 ASQLAQQKEFNLKKPPSYHYDLLLLGFLV 330 >gb|PPR90350.1| hypothetical protein GOBAR_AA30334 [Gossypium barbadense] Length = 714 Score = 60.1 bits (144), Expect = 4e-07 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +2 Query: 2 ASQLAQQSEFNLKKPPSYHYDLLLLGFLV 88 ASQLAQQ EFNLKKPPSYHYDLLLLGFLV Sbjct: 314 ASQLAQQKEFNLKKPPSYHYDLLLLGFLV 342 >ref|XP_016741829.1| PREDICTED: probable boron transporter 2 isoform X1 [Gossypium hirsutum] Length = 715 Score = 60.1 bits (144), Expect = 4e-07 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +2 Query: 2 ASQLAQQSEFNLKKPPSYHYDLLLLGFLV 88 ASQLAQQ EFNLKKPPSYHYDLLLLGFLV Sbjct: 315 ASQLAQQKEFNLKKPPSYHYDLLLLGFLV 343 >ref|XP_012478586.1| PREDICTED: probable boron transporter 2 isoform X1 [Gossypium raimondii] gb|KJB30288.1| hypothetical protein B456_005G135900 [Gossypium raimondii] Length = 715 Score = 60.1 bits (144), Expect = 4e-07 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +2 Query: 2 ASQLAQQSEFNLKKPPSYHYDLLLLGFLV 88 ASQLAQQ EFNLKKPPSYHYDLLLLGFLV Sbjct: 315 ASQLAQQKEFNLKKPPSYHYDLLLLGFLV 343 >ref|XP_017623081.1| PREDICTED: probable boron transporter 2 isoform X1 [Gossypium arboreum] gb|KHG05664.1| Boron transporter 1 -like protein [Gossypium arboreum] Length = 715 Score = 60.1 bits (144), Expect = 4e-07 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +2 Query: 2 ASQLAQQSEFNLKKPPSYHYDLLLLGFLV 88 ASQLAQQ EFNLKKPPSYHYDLLLLGFLV Sbjct: 315 ASQLAQQKEFNLKKPPSYHYDLLLLGFLV 343 >ref|XP_022736165.1| boron transporter 1-like isoform X1 [Durio zibethinus] ref|XP_022736166.1| boron transporter 1-like isoform X1 [Durio zibethinus] Length = 719 Score = 60.1 bits (144), Expect = 4e-07 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +2 Query: 2 ASQLAQQSEFNLKKPPSYHYDLLLLGFLV 88 ASQLAQQ EFNLKKPPSYHYDLLLLGFLV Sbjct: 315 ASQLAQQKEFNLKKPPSYHYDLLLLGFLV 343 >ref|XP_021292535.1| probable boron transporter 2 [Herrania umbratica] Length = 720 Score = 60.1 bits (144), Expect = 4e-07 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +2 Query: 2 ASQLAQQSEFNLKKPPSYHYDLLLLGFLV 88 ASQLAQQ EFNLKKPPSYHYDLLLLGFLV Sbjct: 315 ASQLAQQKEFNLKKPPSYHYDLLLLGFLV 343 >ref|XP_017973464.1| PREDICTED: probable boron transporter 2 [Theobroma cacao] gb|EOY20738.1| HCO3- transporter family [Theobroma cacao] Length = 720 Score = 60.1 bits (144), Expect = 4e-07 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +2 Query: 2 ASQLAQQSEFNLKKPPSYHYDLLLLGFLV 88 ASQLAQQ EFNLKKPPSYHYDLLLLGFLV Sbjct: 315 ASQLAQQKEFNLKKPPSYHYDLLLLGFLV 343 >gb|PON59650.1| Bicarbonate transporter [Trema orientalis] Length = 729 Score = 60.1 bits (144), Expect = 4e-07 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +2 Query: 2 ASQLAQQSEFNLKKPPSYHYDLLLLGFLV 88 ASQLAQQ EFNLKKPPSYHYDLLLLGFLV Sbjct: 322 ASQLAQQKEFNLKKPPSYHYDLLLLGFLV 350 >gb|EXB75660.1| putative boron transporter 2 [Morus notabilis] Length = 705 Score = 59.3 bits (142), Expect = 7e-07 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +2 Query: 2 ASQLAQQSEFNLKKPPSYHYDLLLLGFLV 88 ASQLAQQ EFNLKKPPSYHYDLLLLGF+V Sbjct: 312 ASQLAQQQEFNLKKPPSYHYDLLLLGFMV 340