BLASTX nr result
ID: Chrysanthemum22_contig00025758
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00025758 (392 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021998884.1| glutaminyl-peptide cyclotransferase-like [He... 83 5e-16 ref|XP_023769463.1| glutaminyl-peptide cyclotransferase [Lactuca... 77 6e-14 gb|KVI07125.1| Glutamine cyclotransferase, partial [Cynara cardu... 70 3e-11 ref|XP_022735902.1| glutaminyl-peptide cyclotransferase-like iso... 67 1e-10 ref|XP_022735901.1| glutaminyl-peptide cyclotransferase-like iso... 67 1e-10 ref|XP_010261330.1| PREDICTED: glutaminyl-peptide cyclotransfera... 65 7e-10 ref|XP_010261329.1| PREDICTED: glutaminyl-peptide cyclotransfera... 65 7e-10 gb|PIA49230.1| hypothetical protein AQUCO_01300224v1 [Aquilegia ... 64 1e-09 gb|PIA49229.1| hypothetical protein AQUCO_01300224v1 [Aquilegia ... 64 2e-09 gb|PIA49231.1| hypothetical protein AQUCO_01300224v1 [Aquilegia ... 64 3e-09 ref|XP_002867595.1| glutaminyl-peptide cyclotransferase [Arabido... 64 3e-09 gb|KZV43326.1| glutaminyl-peptide cyclotransferase-like [Dorcoce... 64 3e-09 ref|XP_022878865.1| glutaminyl-peptide cyclotransferase-like iso... 63 3e-09 gb|KMT12950.1| hypothetical protein BVRB_4g090320 isoform B [Bet... 60 4e-09 ref|XP_022878847.1| glutaminyl-peptide cyclotransferase-like iso... 63 5e-09 gb|PHT53246.1| hypothetical protein CQW23_07708 [Capsicum baccatum] 63 6e-09 ref|XP_016564507.1| PREDICTED: glutaminyl-peptide cyclotransfera... 63 6e-09 gb|PHU23146.1| Glutaminyl-peptide cyclotransferase [Capsicum chi... 63 8e-09 ref|XP_012090183.1| glutaminyl-peptide cyclotransferase [Jatroph... 62 9e-09 ref|XP_004308052.1| PREDICTED: glutaminyl-peptide cyclotransfera... 62 9e-09 >ref|XP_021998884.1| glutaminyl-peptide cyclotransferase-like [Helianthus annuus] gb|OTG06105.1| putative glutamine cyclotransferase, WD40/YVTN repeat-like-containing domain protein [Helianthus annuus] Length = 365 Score = 82.8 bits (203), Expect = 5e-16 Identities = 41/49 (83%), Positives = 43/49 (87%) Frame = +1 Query: 244 NTWSSFRSDGRAVLSHQVYSYEVVNVFPHDPNAFTQGLLYGGNDTLLES 390 NTWSSFRSD AV+S Q+YS EVVN FPHDP AFTQGLLYGGNDTLLES Sbjct: 100 NTWSSFRSD--AVVSAQIYSIEVVNEFPHDPAAFTQGLLYGGNDTLLES 146 >ref|XP_023769463.1| glutaminyl-peptide cyclotransferase [Lactuca sativa] gb|PLY81114.1| hypothetical protein LSAT_9X56621 [Lactuca sativa] Length = 366 Score = 77.0 bits (188), Expect = 6e-14 Identities = 38/49 (77%), Positives = 41/49 (83%) Frame = +1 Query: 244 NTWSSFRSDGRAVLSHQVYSYEVVNVFPHDPNAFTQGLLYGGNDTLLES 390 NTWSSFRS V+S Q++S EVVN FPHDP AFTQGLLYGGNDTLLES Sbjct: 100 NTWSSFRSTD--VVSEQIHSIEVVNEFPHDPAAFTQGLLYGGNDTLLES 146 >gb|KVI07125.1| Glutamine cyclotransferase, partial [Cynara cardunculus var. scolymus] Length = 385 Score = 69.7 bits (169), Expect = 3e-11 Identities = 34/49 (69%), Positives = 41/49 (83%) Frame = +1 Query: 244 NTWSSFRSDGRAVLSHQVYSYEVVNVFPHDPNAFTQGLLYGGNDTLLES 390 NT S FRS+ ++ Q++S+EVVN FPHDP+AFTQGLLYGGNDTLLES Sbjct: 100 NTLSFFRSN--TPVTDQIHSFEVVNEFPHDPDAFTQGLLYGGNDTLLES 146 >ref|XP_022735902.1| glutaminyl-peptide cyclotransferase-like isoform X2 [Durio zibethinus] Length = 295 Score = 67.4 bits (163), Expect = 1e-10 Identities = 32/49 (65%), Positives = 36/49 (73%) Frame = +1 Query: 244 NTWSSFRSDGRAVLSHQVYSYEVVNVFPHDPNAFTQGLLYGGNDTLLES 390 NTW SD LS Q+Y Y+VVN FPHDP+AFTQGL+Y GNDTL ES Sbjct: 54 NTWIKISSDN---LSIQLYGYQVVNEFPHDPSAFTQGLVYAGNDTLFES 99 >ref|XP_022735901.1| glutaminyl-peptide cyclotransferase-like isoform X1 [Durio zibethinus] Length = 315 Score = 67.4 bits (163), Expect = 1e-10 Identities = 32/49 (65%), Positives = 36/49 (73%) Frame = +1 Query: 244 NTWSSFRSDGRAVLSHQVYSYEVVNVFPHDPNAFTQGLLYGGNDTLLES 390 NTW SD LS Q+Y Y+VVN FPHDP+AFTQGL+Y GNDTL ES Sbjct: 54 NTWIKISSDN---LSIQLYGYQVVNEFPHDPSAFTQGLVYAGNDTLFES 99 >ref|XP_010261330.1| PREDICTED: glutaminyl-peptide cyclotransferase isoform X2 [Nelumbo nucifera] Length = 318 Score = 65.5 bits (158), Expect = 7e-10 Identities = 30/37 (81%), Positives = 32/37 (86%) Frame = +1 Query: 280 VLSHQVYSYEVVNVFPHDPNAFTQGLLYGGNDTLLES 390 V S ++YS EVVN FPHDPNAFTQGLLYGGNDTL ES Sbjct: 63 VSSTRIYSIEVVNEFPHDPNAFTQGLLYGGNDTLFES 99 >ref|XP_010261329.1| PREDICTED: glutaminyl-peptide cyclotransferase isoform X1 [Nelumbo nucifera] Length = 320 Score = 65.5 bits (158), Expect = 7e-10 Identities = 30/37 (81%), Positives = 32/37 (86%) Frame = +1 Query: 280 VLSHQVYSYEVVNVFPHDPNAFTQGLLYGGNDTLLES 390 V S ++YS EVVN FPHDPNAFTQGLLYGGNDTL ES Sbjct: 63 VSSTRIYSIEVVNEFPHDPNAFTQGLLYGGNDTLFES 99 >gb|PIA49230.1| hypothetical protein AQUCO_01300224v1 [Aquilegia coerulea] Length = 226 Score = 63.9 bits (154), Expect = 1e-09 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = +1 Query: 280 VLSHQVYSYEVVNVFPHDPNAFTQGLLYGGNDTLLES 390 V+S Q+ S EVVN FPHDPNAFTQGLLYGGNDT ES Sbjct: 71 VISSQISSIEVVNEFPHDPNAFTQGLLYGGNDTFFES 107 >gb|PIA49229.1| hypothetical protein AQUCO_01300224v1 [Aquilegia coerulea] Length = 321 Score = 63.9 bits (154), Expect = 2e-09 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = +1 Query: 280 VLSHQVYSYEVVNVFPHDPNAFTQGLLYGGNDTLLES 390 V+S Q+ S EVVN FPHDPNAFTQGLLYGGNDT ES Sbjct: 71 VISSQISSIEVVNEFPHDPNAFTQGLLYGGNDTFFES 107 >gb|PIA49231.1| hypothetical protein AQUCO_01300224v1 [Aquilegia coerulea] Length = 331 Score = 63.9 bits (154), Expect = 3e-09 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = +1 Query: 280 VLSHQVYSYEVVNVFPHDPNAFTQGLLYGGNDTLLES 390 V+S Q+ S EVVN FPHDPNAFTQGLLYGGNDT ES Sbjct: 71 VISSQISSIEVVNEFPHDPNAFTQGLLYGGNDTFFES 107 >ref|XP_002867595.1| glutaminyl-peptide cyclotransferase [Arabidopsis lyrata subsp. lyrata] gb|EFH43854.1| glutamine cyclotransferase family protein [Arabidopsis lyrata subsp. lyrata] Length = 317 Score = 63.5 bits (153), Expect = 3e-09 Identities = 30/49 (61%), Positives = 36/49 (73%) Frame = +1 Query: 244 NTWSSFRSDGRAVLSHQVYSYEVVNVFPHDPNAFTQGLLYGGNDTLLES 390 N+W +S G LSH+++ EVV FPHDP+AFTQGLLY GNDTL ES Sbjct: 56 NSWG--QSSGSLDLSHRIHEIEVVAEFPHDPDAFTQGLLYAGNDTLFES 102 >gb|KZV43326.1| glutaminyl-peptide cyclotransferase-like [Dorcoceras hygrometricum] Length = 323 Score = 63.5 bits (153), Expect = 3e-09 Identities = 34/49 (69%), Positives = 35/49 (71%) Frame = +1 Query: 244 NTWSSFRSDGRAVLSHQVYSYEVVNVFPHDPNAFTQGLLYGGNDTLLES 390 N S+F SD R L VYS EVV VFPHDPNAFTQGLLY GNDT ES Sbjct: 59 NMRSAFGSDHRLDL---VYSAEVVRVFPHDPNAFTQGLLYAGNDTFFES 104 >ref|XP_022878865.1| glutaminyl-peptide cyclotransferase-like isoform X3 [Olea europaea var. sylvestris] Length = 271 Score = 63.2 bits (152), Expect = 3e-09 Identities = 32/53 (60%), Positives = 35/53 (66%), Gaps = 4/53 (7%) Frame = +1 Query: 244 NTWSSF----RSDGRAVLSHQVYSYEVVNVFPHDPNAFTQGLLYGGNDTLLES 390 N WS F S+ L Q+Y+ EVVN FPHDPNAFTQGLLY NDTL ES Sbjct: 58 NIWSVFGSKPSSNPNQALLDQIYNVEVVNEFPHDPNAFTQGLLYAENDTLFES 110 >gb|KMT12950.1| hypothetical protein BVRB_4g090320 isoform B [Beta vulgaris subsp. vulgaris] Length = 102 Score = 60.1 bits (144), Expect = 4e-09 Identities = 29/50 (58%), Positives = 37/50 (74%), Gaps = 1/50 (2%) Frame = +1 Query: 244 NTWSSFRSDGRAVLS-HQVYSYEVVNVFPHDPNAFTQGLLYGGNDTLLES 390 NT S+ D + + Q+Y+ EVVNV+PHDP AFT+GLLYGGN+TL ES Sbjct: 35 NTLSALPLDSQKNIQLPQIYTIEVVNVYPHDPRAFTEGLLYGGNNTLYES 84 >ref|XP_022878847.1| glutaminyl-peptide cyclotransferase-like isoform X1 [Olea europaea var. sylvestris] Length = 333 Score = 63.2 bits (152), Expect = 5e-09 Identities = 32/53 (60%), Positives = 35/53 (66%), Gaps = 4/53 (7%) Frame = +1 Query: 244 NTWSSF----RSDGRAVLSHQVYSYEVVNVFPHDPNAFTQGLLYGGNDTLLES 390 N WS F S+ L Q+Y+ EVVN FPHDPNAFTQGLLY NDTL ES Sbjct: 58 NIWSVFGSKPSSNPNQALLDQIYNVEVVNEFPHDPNAFTQGLLYAENDTLFES 110 >gb|PHT53246.1| hypothetical protein CQW23_07708 [Capsicum baccatum] Length = 325 Score = 62.8 bits (151), Expect = 6e-09 Identities = 32/46 (69%), Positives = 35/46 (76%) Frame = +1 Query: 253 SSFRSDGRAVLSHQVYSYEVVNVFPHDPNAFTQGLLYGGNDTLLES 390 S FRSD V S+Q+Y+ EVVN FPHDP AFTQGLLY NDTL ES Sbjct: 62 SDFRSD---VPSNQLYTVEVVNEFPHDPEAFTQGLLYADNDTLFES 104 >ref|XP_016564507.1| PREDICTED: glutaminyl-peptide cyclotransferase-like [Capsicum annuum] gb|PHT87378.1| Glutaminyl-peptide cyclotransferase [Capsicum annuum] Length = 325 Score = 62.8 bits (151), Expect = 6e-09 Identities = 32/46 (69%), Positives = 35/46 (76%) Frame = +1 Query: 253 SSFRSDGRAVLSHQVYSYEVVNVFPHDPNAFTQGLLYGGNDTLLES 390 S FRSD V S+Q+Y+ EVVN FPHDP AFTQGLLY NDTL ES Sbjct: 62 SDFRSD---VPSNQLYTVEVVNEFPHDPEAFTQGLLYADNDTLFES 104 >gb|PHU23146.1| Glutaminyl-peptide cyclotransferase [Capsicum chinense] Length = 453 Score = 62.8 bits (151), Expect = 8e-09 Identities = 32/46 (69%), Positives = 35/46 (76%) Frame = +1 Query: 253 SSFRSDGRAVLSHQVYSYEVVNVFPHDPNAFTQGLLYGGNDTLLES 390 S FRSD V S+Q+Y+ EVVN FPHDP AFTQGLLY NDTL ES Sbjct: 57 SDFRSD---VPSNQLYTVEVVNEFPHDPEAFTQGLLYADNDTLFES 99 >ref|XP_012090183.1| glutaminyl-peptide cyclotransferase [Jatropha curcas] gb|KDP22225.1| hypothetical protein JCGZ_26056 [Jatropha curcas] Length = 317 Score = 62.4 bits (150), Expect = 9e-09 Identities = 29/47 (61%), Positives = 35/47 (74%) Frame = +1 Query: 250 WSSFRSDGRAVLSHQVYSYEVVNVFPHDPNAFTQGLLYGGNDTLLES 390 WSS S LS ++Y+ +V+N FPHDPNAFTQGLLY GNDT+ ES Sbjct: 58 WSSLASGD---LSSKIYTIQVLNEFPHDPNAFTQGLLYAGNDTIFES 101 >ref|XP_004308052.1| PREDICTED: glutaminyl-peptide cyclotransferase [Fragaria vesca subsp. vesca] Length = 324 Score = 62.4 bits (150), Expect = 9e-09 Identities = 31/49 (63%), Positives = 34/49 (69%) Frame = +1 Query: 244 NTWSSFRSDGRAVLSHQVYSYEVVNVFPHDPNAFTQGLLYGGNDTLLES 390 NTWSS G + VYS +VVN FPHDPNAFTQGLLY GN +L ES Sbjct: 58 NTWSS---PGNDAAFNAVYSIQVVNQFPHDPNAFTQGLLYAGNGSLFES 103