BLASTX nr result
ID: Chrysanthemum22_contig00025587
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00025587 (352 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVH95113.1| Biopterin transport-related protein BT1 [Cynara c... 108 3e-25 ref|XP_022020636.1| probable folate-biopterin transporter 2 [Hel... 101 1e-22 ref|XP_023768751.1| probable folate-biopterin transporter 2 [Lac... 97 5e-21 >gb|KVH95113.1| Biopterin transport-related protein BT1 [Cynara cardunculus var. scolymus] Length = 519 Score = 108 bits (270), Expect = 3e-25 Identities = 55/72 (76%), Positives = 63/72 (87%) Frame = +1 Query: 1 AILIRNILRITPLCFLFLVPKSGPDSLGFSRMEVLDIVEDSESCIQVSTVLEDSKLSKPE 180 AILIRN+LRI PL FLFLVPKS P+S GFSRMEVL I+ED ES I+VS +LEDS+LSK E Sbjct: 448 AILIRNVLRIVPLAFLFLVPKSSPESSGFSRMEVLSILEDGESHIEVSGILEDSELSKSE 507 Query: 181 EVELTPLVSSVG 216 EVELTPLVS++G Sbjct: 508 EVELTPLVSNIG 519 >ref|XP_022020636.1| probable folate-biopterin transporter 2 [Helianthus annuus] gb|OTF85108.1| putative major facilitator superfamily protein [Helianthus annuus] Length = 513 Score = 101 bits (251), Expect = 1e-22 Identities = 51/70 (72%), Positives = 59/70 (84%) Frame = +1 Query: 1 AILIRNILRITPLCFLFLVPKSGPDSLGFSRMEVLDIVEDSESCIQVSTVLEDSKLSKPE 180 AILIRN+LRI PLCFLFLVPK G DS GFSR+EVL +V+D ES I+V +V ED++ SK E Sbjct: 444 AILIRNVLRIVPLCFLFLVPKGGSDSSGFSRLEVLQVVDDGESDIEVLSVSEDAEASKAE 503 Query: 181 EVELTPLVSS 210 EVELTPLVSS Sbjct: 504 EVELTPLVSS 513 >ref|XP_023768751.1| probable folate-biopterin transporter 2 [Lactuca sativa] ref|XP_023768752.1| probable folate-biopterin transporter 2 [Lactuca sativa] ref|XP_023768753.1| probable folate-biopterin transporter 2 [Lactuca sativa] gb|PLY81772.1| hypothetical protein LSAT_3X22800 [Lactuca sativa] Length = 520 Score = 97.1 bits (240), Expect = 5e-21 Identities = 52/74 (70%), Positives = 61/74 (82%), Gaps = 3/74 (4%) Frame = +1 Query: 1 AILIRNILRITPLCFLFLVPKSGPDSLGFSRMEVLDIVEDSESCIQVSTVLEDSK---LS 171 AILIRN+LRI PLCFLFLVPKS +SLGFSRMEVL+++EDSE+ IQVS+ LE+ L Sbjct: 445 AILIRNVLRIVPLCFLFLVPKSDAESLGFSRMEVLNVLEDSENGIQVSSSLEEDSEILLK 504 Query: 172 KPEEVELTPLVSSV 213 EEVELTPLV+SV Sbjct: 505 HAEEVELTPLVTSV 518