BLASTX nr result
ID: Chrysanthemum22_contig00025372
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00025372 (415 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB95062.1| hypothetical protein L484_003540 [Morus notabilis] 68 5e-12 gb|KDO46163.1| hypothetical protein CISIN_1g0046351mg, partial [... 66 1e-11 emb|CAN67600.1| hypothetical protein VITISV_012281 [Vitis vinifera] 68 1e-11 gb|PKI71758.1| hypothetical protein CRG98_007891 [Punica granatum] 67 2e-11 gb|PNY09721.1| dolichyl-diphosphooligosaccharide-protein glycosy... 65 4e-11 gb|KVI07809.1| Oligosaccharyl transferase, STT3 subunit [Cynara ... 68 1e-10 emb|CDO98566.1| unnamed protein product [Coffea canephora] 68 1e-10 dbj|GAV73616.1| STT3 domain-containing protein [Cephalotus folli... 68 1e-10 ref|XP_006847859.1| dolichyl-diphosphooligosaccharide--protein g... 68 1e-10 ref|XP_019175470.1| PREDICTED: dolichyl-diphosphooligosaccharide... 68 1e-10 ref|XP_010687248.1| PREDICTED: dolichyl-diphosphooligosaccharide... 68 1e-10 ref|XP_021673614.1| dolichyl-diphosphooligosaccharide--protein g... 68 1e-10 ref|XP_024170924.1| dolichyl-diphosphooligosaccharide--protein g... 68 1e-10 gb|KVI04796.1| hypothetical protein Ccrd_016881 [Cynara carduncu... 68 1e-10 ref|XP_015901745.1| PREDICTED: dolichyl-diphosphooligosaccharide... 68 2e-10 emb|CBI35275.3| unnamed protein product, partial [Vitis vinifera] 68 2e-10 ref|XP_021678775.1| dolichyl-diphosphooligosaccharide--protein g... 68 2e-10 gb|KZV34783.1| hypothetical protein F511_00685 [Dorcoceras hygro... 68 2e-10 ref|XP_024025760.1| dolichyl-diphosphooligosaccharide--protein g... 68 2e-10 ref|XP_004299463.1| PREDICTED: dolichyl-diphosphooligosaccharide... 68 2e-10 >gb|EXB95062.1| hypothetical protein L484_003540 [Morus notabilis] Length = 102 Score = 67.8 bits (164), Expect = 5e-12 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -1 Query: 415 KDVKLEYLEEAFTTSNWIVRIYKVKPPGNRW 323 KD+KLEYLEEAFTTSNWIVRIYKVKPP NRW Sbjct: 72 KDIKLEYLEEAFTTSNWIVRIYKVKPPNNRW 102 >gb|KDO46163.1| hypothetical protein CISIN_1g0046351mg, partial [Citrus sinensis] Length = 62 Score = 65.9 bits (159), Expect = 1e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -1 Query: 415 KDVKLEYLEEAFTTSNWIVRIYKVKPPGNRW 323 KD+KLE+LEEAFTTSNWIVRIYKVKPP NRW Sbjct: 32 KDIKLEHLEEAFTTSNWIVRIYKVKPPNNRW 62 >emb|CAN67600.1| hypothetical protein VITISV_012281 [Vitis vinifera] Length = 140 Score = 67.8 bits (164), Expect = 1e-11 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -1 Query: 415 KDVKLEYLEEAFTTSNWIVRIYKVKPPGNRW 323 KD+KLEYLEEAFTTSNWIVRIYKVKPP NRW Sbjct: 110 KDIKLEYLEEAFTTSNWIVRIYKVKPPNNRW 140 >gb|PKI71758.1| hypothetical protein CRG98_007891 [Punica granatum] Length = 140 Score = 67.0 bits (162), Expect = 2e-11 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -1 Query: 415 KDVKLEYLEEAFTTSNWIVRIYKVKPPGNRW 323 KD+KLEYLEEAFTTSNWIVRIYKVKPP NRW Sbjct: 110 KDIKLEYLEEAFTTSNWIVRIYKVKPPKNRW 140 >gb|PNY09721.1| dolichyl-diphosphooligosaccharide-protein glycosyltransferase [Trifolium pratense] Length = 100 Score = 65.5 bits (158), Expect = 4e-11 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -1 Query: 415 KDVKLEYLEEAFTTSNWIVRIYKVKPPGNRW 323 KD+KLEYLEEAFTT NWIVRIYKVKPP NRW Sbjct: 70 KDIKLEYLEEAFTTQNWIVRIYKVKPPKNRW 100 >gb|KVI07809.1| Oligosaccharyl transferase, STT3 subunit [Cynara cardunculus var. scolymus] Length = 578 Score = 68.2 bits (165), Expect = 1e-10 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -1 Query: 415 KDVKLEYLEEAFTTSNWIVRIYKVKPPGNRW 323 KDVKLEYLEEAFTTSNWIVRIYKVKPP NRW Sbjct: 548 KDVKLEYLEEAFTTSNWIVRIYKVKPPSNRW 578 >emb|CDO98566.1| unnamed protein product [Coffea canephora] Length = 725 Score = 68.2 bits (165), Expect = 1e-10 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -1 Query: 415 KDVKLEYLEEAFTTSNWIVRIYKVKPPGNRW 323 KDVKLEYLEEAFTTSNWIVRIYKVKPP NRW Sbjct: 695 KDVKLEYLEEAFTTSNWIVRIYKVKPPNNRW 725 >dbj|GAV73616.1| STT3 domain-containing protein [Cephalotus follicularis] Length = 727 Score = 68.2 bits (165), Expect = 1e-10 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -1 Query: 415 KDVKLEYLEEAFTTSNWIVRIYKVKPPGNRW 323 KDVKLEYLEEAFTTSNWIVRIYKVKPP NRW Sbjct: 697 KDVKLEYLEEAFTTSNWIVRIYKVKPPNNRW 727 >ref|XP_006847859.1| dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B [Amborella trichopoda] gb|ERN09440.1| hypothetical protein AMTR_s00029p00078080 [Amborella trichopoda] Length = 733 Score = 68.2 bits (165), Expect = 1e-10 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -1 Query: 415 KDVKLEYLEEAFTTSNWIVRIYKVKPPGNRW 323 KDVKLEYLEEAFTTSNWIVRIYKVKPP NRW Sbjct: 703 KDVKLEYLEEAFTTSNWIVRIYKVKPPSNRW 733 >ref|XP_019175470.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B [Ipomoea nil] Length = 735 Score = 68.2 bits (165), Expect = 1e-10 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -1 Query: 415 KDVKLEYLEEAFTTSNWIVRIYKVKPPGNRW 323 KDVKLEYLEEAFTTSNWIVRIYKVKPP NRW Sbjct: 705 KDVKLEYLEEAFTTSNWIVRIYKVKPPNNRW 735 >ref|XP_010687248.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B [Beta vulgaris subsp. vulgaris] gb|KMT03725.1| hypothetical protein BVRB_8g188740 [Beta vulgaris subsp. vulgaris] Length = 740 Score = 68.2 bits (165), Expect = 1e-10 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -1 Query: 415 KDVKLEYLEEAFTTSNWIVRIYKVKPPGNRW 323 KDVKLEYLEEAFTTSNWIVRIYKVKPP NRW Sbjct: 710 KDVKLEYLEEAFTTSNWIVRIYKVKPPNNRW 740 >ref|XP_021673614.1| dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B isoform X2 [Hevea brasiliensis] Length = 742 Score = 68.2 bits (165), Expect = 1e-10 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -1 Query: 415 KDVKLEYLEEAFTTSNWIVRIYKVKPPGNRW 323 KDVKLEYLEEAFTTSNWIVRIYKVKPP NRW Sbjct: 712 KDVKLEYLEEAFTTSNWIVRIYKVKPPNNRW 742 >ref|XP_024170924.1| dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B [Rosa chinensis] gb|PRQ15775.1| putative dolichyl-diphosphooligosaccharide--protein glycotransferase [Rosa chinensis] Length = 743 Score = 68.2 bits (165), Expect = 1e-10 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -1 Query: 415 KDVKLEYLEEAFTTSNWIVRIYKVKPPGNRW 323 KDVKLEYLEEAFTTSNWIVRIYKVKPP NRW Sbjct: 713 KDVKLEYLEEAFTTSNWIVRIYKVKPPNNRW 743 >gb|KVI04796.1| hypothetical protein Ccrd_016881 [Cynara cardunculus var. scolymus] Length = 843 Score = 68.2 bits (165), Expect = 1e-10 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -1 Query: 415 KDVKLEYLEEAFTTSNWIVRIYKVKPPGNRW 323 KDVKLEYLEEAFTTSNWIVRIYKVKPP NRW Sbjct: 781 KDVKLEYLEEAFTTSNWIVRIYKVKPPSNRW 811 >ref|XP_015901745.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B-like [Ziziphus jujuba] Length = 483 Score = 67.8 bits (164), Expect = 2e-10 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -1 Query: 415 KDVKLEYLEEAFTTSNWIVRIYKVKPPGNRW 323 KD+KLEYLEEAFTTSNWIVRIYKVKPP NRW Sbjct: 453 KDIKLEYLEEAFTTSNWIVRIYKVKPPNNRW 483 >emb|CBI35275.3| unnamed protein product, partial [Vitis vinifera] Length = 554 Score = 67.8 bits (164), Expect = 2e-10 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -1 Query: 415 KDVKLEYLEEAFTTSNWIVRIYKVKPPGNRW 323 KD+KLEYLEEAFTTSNWIVRIYKVKPP NRW Sbjct: 524 KDIKLEYLEEAFTTSNWIVRIYKVKPPNNRW 554 >ref|XP_021678775.1| dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B-like isoform X2 [Hevea brasiliensis] Length = 723 Score = 67.8 bits (164), Expect = 2e-10 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -1 Query: 415 KDVKLEYLEEAFTTSNWIVRIYKVKPPGNRW 323 KD+KLEYLEEAFTTSNWIVRIYKVKPP NRW Sbjct: 693 KDIKLEYLEEAFTTSNWIVRIYKVKPPNNRW 723 >gb|KZV34783.1| hypothetical protein F511_00685 [Dorcoceras hygrometricum] Length = 731 Score = 67.8 bits (164), Expect = 2e-10 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -1 Query: 415 KDVKLEYLEEAFTTSNWIVRIYKVKPPGNRW 323 KD+KLEYLEEAFTTSNWIVRIYKVKPP NRW Sbjct: 701 KDIKLEYLEEAFTTSNWIVRIYKVKPPNNRW 731 >ref|XP_024025760.1| dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B [Morus notabilis] Length = 733 Score = 67.8 bits (164), Expect = 2e-10 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -1 Query: 415 KDVKLEYLEEAFTTSNWIVRIYKVKPPGNRW 323 KD+KLEYLEEAFTTSNWIVRIYKVKPP NRW Sbjct: 703 KDIKLEYLEEAFTTSNWIVRIYKVKPPNNRW 733 >ref|XP_004299463.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B [Fragaria vesca subsp. vesca] Length = 738 Score = 67.8 bits (164), Expect = 2e-10 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -1 Query: 415 KDVKLEYLEEAFTTSNWIVRIYKVKPPGNRW 323 KD+KLEYLEEAFTTSNWIVRIYKVKPP NRW Sbjct: 708 KDIKLEYLEEAFTTSNWIVRIYKVKPPNNRW 738