BLASTX nr result
ID: Chrysanthemum22_contig00025227
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00025227 (434 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVI06365.1| Pentatricopeptide repeat-containing protein [Cyna... 141 5e-36 ref|XP_008356673.2| PREDICTED: pentatricopeptide repeat-containi... 140 7e-36 ref|XP_008346758.1| PREDICTED: pentatricopeptide repeat-containi... 140 9e-36 ref|XP_010272206.1| PREDICTED: pentatricopeptide repeat-containi... 140 9e-36 ref|XP_020548243.1| LOW QUALITY PROTEIN: pentatricopeptide repea... 139 2e-35 emb|CDP14888.1| unnamed protein product [Coffea canephora] 138 4e-35 ref|XP_009343436.1| PREDICTED: pentatricopeptide repeat-containi... 138 6e-35 ref|XP_009369368.1| PREDICTED: pentatricopeptide repeat-containi... 138 6e-35 ref|XP_021983949.1| pentatricopeptide repeat-containing protein ... 137 8e-35 gb|PIN07708.1| hypothetical protein CDL12_19718 [Handroanthus im... 137 8e-35 ref|XP_022135050.1| pentatricopeptide repeat-containing protein ... 137 8e-35 gb|OTG16430.1| putative pentatricopeptide repeat (PPR) superfami... 137 8e-35 ref|XP_021808393.1| pentatricopeptide repeat-containing protein ... 137 1e-34 ref|XP_008239656.1| PREDICTED: pentatricopeptide repeat-containi... 137 1e-34 ref|XP_007210374.1| pentatricopeptide repeat-containing protein ... 137 1e-34 ref|XP_018831595.1| PREDICTED: pentatricopeptide repeat-containi... 137 1e-34 ref|XP_018445813.1| PREDICTED: pentatricopeptide repeat-containi... 136 2e-34 gb|PKI78031.1| hypothetical protein CRG98_001651 [Punica granatum] 134 2e-34 gb|EFH63816.1| pentatricopeptide repeat-containing protein [Arab... 136 2e-34 ref|XP_020890662.1| pentatricopeptide repeat-containing protein ... 136 2e-34 >gb|KVI06365.1| Pentatricopeptide repeat-containing protein [Cynara cardunculus var. scolymus] Length = 861 Score = 141 bits (355), Expect = 5e-36 Identities = 66/71 (92%), Positives = 68/71 (95%) Frame = -1 Query: 434 VCPSRIDIVTGWGRRSRVTGTSLVRQSVQELLNIFQFPFFTENGNSGCFVGCGEPLCRWL 255 VCPSRIDIVTGWGRRSRVTG+SLVRQSVQELLNIF FPFFTENGN+GCFVGCGEPL RWL Sbjct: 791 VCPSRIDIVTGWGRRSRVTGSSLVRQSVQELLNIFGFPFFTENGNTGCFVGCGEPLSRWL 850 Query: 254 DQSYVERMHLL 222 QSYVERMHLL Sbjct: 851 VQSYVERMHLL 861 >ref|XP_008356673.2| PREDICTED: pentatricopeptide repeat-containing protein At1g74750-like [Malus domestica] Length = 710 Score = 140 bits (353), Expect = 7e-36 Identities = 64/71 (90%), Positives = 69/71 (97%) Frame = -1 Query: 434 VCPSRIDIVTGWGRRSRVTGTSLVRQSVQELLNIFQFPFFTENGNSGCFVGCGEPLCRWL 255 +CPSRIDIVTGWGRRSRVTG+SLVRQ+VQELLN+F+FPFFTENGNSGCFVGCGEPL RWL Sbjct: 640 ICPSRIDIVTGWGRRSRVTGSSLVRQAVQELLNVFRFPFFTENGNSGCFVGCGEPLNRWL 699 Query: 254 DQSYVERMHLL 222 QSYVERMHLL Sbjct: 700 LQSYVERMHLL 710 >ref|XP_008346758.1| PREDICTED: pentatricopeptide repeat-containing protein At1g18900-like [Malus domestica] ref|XP_017180880.1| PREDICTED: pentatricopeptide repeat-containing protein At1g18900-like [Malus domestica] ref|XP_017180881.1| PREDICTED: pentatricopeptide repeat-containing protein At1g18900-like [Malus domestica] Length = 874 Score = 140 bits (353), Expect = 9e-36 Identities = 64/71 (90%), Positives = 69/71 (97%) Frame = -1 Query: 434 VCPSRIDIVTGWGRRSRVTGTSLVRQSVQELLNIFQFPFFTENGNSGCFVGCGEPLCRWL 255 +CPSRIDIVTGWGRRSRVTG+SLVRQ+VQELLN+F+FPFFTENGNSGCFVGCGEPL RWL Sbjct: 804 ICPSRIDIVTGWGRRSRVTGSSLVRQAVQELLNVFRFPFFTENGNSGCFVGCGEPLNRWL 863 Query: 254 DQSYVERMHLL 222 QSYVERMHLL Sbjct: 864 LQSYVERMHLL 874 >ref|XP_010272206.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74750-like [Nelumbo nucifera] Length = 880 Score = 140 bits (353), Expect = 9e-36 Identities = 66/71 (92%), Positives = 68/71 (95%) Frame = -1 Query: 434 VCPSRIDIVTGWGRRSRVTGTSLVRQSVQELLNIFQFPFFTENGNSGCFVGCGEPLCRWL 255 + PSRIDIVTGWGRRSRVTG+SLVRQSVQELLNIFQFPFFTENGNSGCFVGCGEPL RWL Sbjct: 810 ISPSRIDIVTGWGRRSRVTGSSLVRQSVQELLNIFQFPFFTENGNSGCFVGCGEPLSRWL 869 Query: 254 DQSYVERMHLL 222 QSYVERMHLL Sbjct: 870 LQSYVERMHLL 880 >ref|XP_020548243.1| LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At1g74750-like [Sesamum indicum] Length = 856 Score = 139 bits (350), Expect = 2e-35 Identities = 63/71 (88%), Positives = 69/71 (97%) Frame = -1 Query: 434 VCPSRIDIVTGWGRRSRVTGTSLVRQSVQELLNIFQFPFFTENGNSGCFVGCGEPLCRWL 255 +CP+RIDIVTGWGRRSRVTGTSLVRQ+VQELLN+F+FPFFTENGNSGCFVGCGEPL +WL Sbjct: 786 ICPTRIDIVTGWGRRSRVTGTSLVRQAVQELLNMFRFPFFTENGNSGCFVGCGEPLSQWL 845 Query: 254 DQSYVERMHLL 222 QSYVERMHLL Sbjct: 846 LQSYVERMHLL 856 >emb|CDP14888.1| unnamed protein product [Coffea canephora] Length = 864 Score = 138 bits (348), Expect = 4e-35 Identities = 63/71 (88%), Positives = 67/71 (94%) Frame = -1 Query: 434 VCPSRIDIVTGWGRRSRVTGTSLVRQSVQELLNIFQFPFFTENGNSGCFVGCGEPLCRWL 255 +CPSRIDIVTGWGRRSRVTG+SLVRQ+VQELLN+F FPF TENGNSGCFVGCGEPL RWL Sbjct: 794 ICPSRIDIVTGWGRRSRVTGSSLVRQAVQELLNVFSFPFVTENGNSGCFVGCGEPLSRWL 853 Query: 254 DQSYVERMHLL 222 QSYVERMHLL Sbjct: 854 VQSYVERMHLL 864 >ref|XP_009343436.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74750-like [Pyrus x bretschneideri] ref|XP_009343437.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74750-like [Pyrus x bretschneideri] Length = 862 Score = 138 bits (347), Expect = 6e-35 Identities = 63/71 (88%), Positives = 67/71 (94%) Frame = -1 Query: 434 VCPSRIDIVTGWGRRSRVTGTSLVRQSVQELLNIFQFPFFTENGNSGCFVGCGEPLCRWL 255 +CPSRIDIVTGWGRRSRVTG+SLVRQ+VQELLN F FPFFTENGNSGCF+GCGEPL RWL Sbjct: 792 ICPSRIDIVTGWGRRSRVTGSSLVRQAVQELLNAFHFPFFTENGNSGCFIGCGEPLNRWL 851 Query: 254 DQSYVERMHLL 222 QSYVERMHLL Sbjct: 852 LQSYVERMHLL 862 >ref|XP_009369368.1| PREDICTED: pentatricopeptide repeat-containing protein At1g18900-like [Pyrus x bretschneideri] ref|XP_009369369.1| PREDICTED: pentatricopeptide repeat-containing protein At1g18900-like [Pyrus x bretschneideri] ref|XP_009369370.1| PREDICTED: pentatricopeptide repeat-containing protein At1g18900-like [Pyrus x bretschneideri] Length = 870 Score = 138 bits (347), Expect = 6e-35 Identities = 63/71 (88%), Positives = 68/71 (95%) Frame = -1 Query: 434 VCPSRIDIVTGWGRRSRVTGTSLVRQSVQELLNIFQFPFFTENGNSGCFVGCGEPLCRWL 255 +CPSRIDIVTGWGRRSRVTG+SLVRQ+VQELL +F+FPFFTENGNSGCFVGCGEPL RWL Sbjct: 800 ICPSRIDIVTGWGRRSRVTGSSLVRQAVQELLKVFRFPFFTENGNSGCFVGCGEPLNRWL 859 Query: 254 DQSYVERMHLL 222 QSYVERMHLL Sbjct: 860 LQSYVERMHLL 870 >ref|XP_021983949.1| pentatricopeptide repeat-containing protein At1g74750-like [Helianthus annuus] Length = 840 Score = 137 bits (346), Expect = 8e-35 Identities = 62/71 (87%), Positives = 68/71 (95%) Frame = -1 Query: 434 VCPSRIDIVTGWGRRSRVTGTSLVRQSVQELLNIFQFPFFTENGNSGCFVGCGEPLCRWL 255 +CPSRIDIVTGWGRRSRVTG+SLVRQSV +LLNIF+FPFFTENGN+GCFVGCGEPL RWL Sbjct: 770 ICPSRIDIVTGWGRRSRVTGSSLVRQSVHDLLNIFRFPFFTENGNTGCFVGCGEPLSRWL 829 Query: 254 DQSYVERMHLL 222 +SYVERMHLL Sbjct: 830 VESYVERMHLL 840 >gb|PIN07708.1| hypothetical protein CDL12_19718 [Handroanthus impetiginosus] Length = 856 Score = 137 bits (346), Expect = 8e-35 Identities = 63/71 (88%), Positives = 68/71 (95%) Frame = -1 Query: 434 VCPSRIDIVTGWGRRSRVTGTSLVRQSVQELLNIFQFPFFTENGNSGCFVGCGEPLCRWL 255 +CPSRIDIVTGWGRRSRVTGTS+VRQ+VQELLN+F+FPFFTENGNSGCFVGCGE L RWL Sbjct: 786 ICPSRIDIVTGWGRRSRVTGTSMVRQAVQELLNMFEFPFFTENGNSGCFVGCGESLNRWL 845 Query: 254 DQSYVERMHLL 222 QSYVERMHLL Sbjct: 846 LQSYVERMHLL 856 >ref|XP_022135050.1| pentatricopeptide repeat-containing protein At1g18900 [Momordica charantia] Length = 878 Score = 137 bits (346), Expect = 8e-35 Identities = 64/71 (90%), Positives = 67/71 (94%) Frame = -1 Query: 434 VCPSRIDIVTGWGRRSRVTGTSLVRQSVQELLNIFQFPFFTENGNSGCFVGCGEPLCRWL 255 V PSRIDIVTGWGRRSRVTG+SLVRQ+VQ+LLNIF FPFFTENGNSGCFVGCGEPL RWL Sbjct: 808 VSPSRIDIVTGWGRRSRVTGSSLVRQAVQDLLNIFSFPFFTENGNSGCFVGCGEPLSRWL 867 Query: 254 DQSYVERMHLL 222 QSYVERMHLL Sbjct: 868 HQSYVERMHLL 878 >gb|OTG16430.1| putative pentatricopeptide repeat (PPR) superfamily protein [Helianthus annuus] Length = 907 Score = 137 bits (346), Expect = 8e-35 Identities = 62/71 (87%), Positives = 68/71 (95%) Frame = -1 Query: 434 VCPSRIDIVTGWGRRSRVTGTSLVRQSVQELLNIFQFPFFTENGNSGCFVGCGEPLCRWL 255 +CPSRIDIVTGWGRRSRVTG+SLVRQSV +LLNIF+FPFFTENGN+GCFVGCGEPL RWL Sbjct: 837 ICPSRIDIVTGWGRRSRVTGSSLVRQSVHDLLNIFRFPFFTENGNTGCFVGCGEPLSRWL 896 Query: 254 DQSYVERMHLL 222 +SYVERMHLL Sbjct: 897 VESYVERMHLL 907 >ref|XP_021808393.1| pentatricopeptide repeat-containing protein At1g18900 [Prunus avium] ref|XP_021808394.1| pentatricopeptide repeat-containing protein At1g18900 [Prunus avium] ref|XP_021808395.1| pentatricopeptide repeat-containing protein At1g18900 [Prunus avium] ref|XP_021808396.1| pentatricopeptide repeat-containing protein At1g18900 [Prunus avium] Length = 870 Score = 137 bits (344), Expect = 1e-34 Identities = 62/71 (87%), Positives = 68/71 (95%) Frame = -1 Query: 434 VCPSRIDIVTGWGRRSRVTGTSLVRQSVQELLNIFQFPFFTENGNSGCFVGCGEPLCRWL 255 +CPSRIDIVTGWGRRSRVTG+SLVRQ+V+ELLN+F FPFFTENGNSGCFVGCGEPL +WL Sbjct: 800 ICPSRIDIVTGWGRRSRVTGSSLVRQAVEELLNMFSFPFFTENGNSGCFVGCGEPLNKWL 859 Query: 254 DQSYVERMHLL 222 QSYVERMHLL Sbjct: 860 LQSYVERMHLL 870 >ref|XP_008239656.1| PREDICTED: pentatricopeptide repeat-containing protein At1g18900 [Prunus mume] Length = 870 Score = 137 bits (344), Expect = 1e-34 Identities = 62/71 (87%), Positives = 68/71 (95%) Frame = -1 Query: 434 VCPSRIDIVTGWGRRSRVTGTSLVRQSVQELLNIFQFPFFTENGNSGCFVGCGEPLCRWL 255 +CPSRIDIVTGWGRRSRVTG+SLVRQ+V+ELLN+F FPFFTENGNSGCFVGCGEPL +WL Sbjct: 800 ICPSRIDIVTGWGRRSRVTGSSLVRQAVEELLNMFSFPFFTENGNSGCFVGCGEPLNKWL 859 Query: 254 DQSYVERMHLL 222 QSYVERMHLL Sbjct: 860 LQSYVERMHLL 870 >ref|XP_007210374.1| pentatricopeptide repeat-containing protein At1g18900 [Prunus persica] ref|XP_020419398.1| pentatricopeptide repeat-containing protein At1g18900 [Prunus persica] gb|ONI08547.1| hypothetical protein PRUPE_5G184700 [Prunus persica] gb|ONI08548.1| hypothetical protein PRUPE_5G184700 [Prunus persica] gb|ONI08549.1| hypothetical protein PRUPE_5G184700 [Prunus persica] gb|ONI08550.1| hypothetical protein PRUPE_5G184700 [Prunus persica] gb|ONI08551.1| hypothetical protein PRUPE_5G184700 [Prunus persica] Length = 870 Score = 137 bits (344), Expect = 1e-34 Identities = 62/71 (87%), Positives = 68/71 (95%) Frame = -1 Query: 434 VCPSRIDIVTGWGRRSRVTGTSLVRQSVQELLNIFQFPFFTENGNSGCFVGCGEPLCRWL 255 +CPSRIDIVTGWGRRSRVTG+SLVRQ+V+ELLN+F FPFFTENGNSGCFVGCGEPL +WL Sbjct: 800 ICPSRIDIVTGWGRRSRVTGSSLVRQAVEELLNMFSFPFFTENGNSGCFVGCGEPLNKWL 859 Query: 254 DQSYVERMHLL 222 QSYVERMHLL Sbjct: 860 LQSYVERMHLL 870 >ref|XP_018831595.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74750-like [Juglans regia] ref|XP_018831596.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74750-like [Juglans regia] ref|XP_018831597.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74750-like [Juglans regia] ref|XP_018831598.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74750-like [Juglans regia] ref|XP_018831599.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74750-like [Juglans regia] Length = 882 Score = 137 bits (344), Expect = 1e-34 Identities = 64/71 (90%), Positives = 67/71 (94%) Frame = -1 Query: 434 VCPSRIDIVTGWGRRSRVTGTSLVRQSVQELLNIFQFPFFTENGNSGCFVGCGEPLCRWL 255 + PSRIDIVTGWGRRSRVTG+SLVRQ+VQELLNIF FPFFTENGNSGCFVGCGEPL RWL Sbjct: 812 IAPSRIDIVTGWGRRSRVTGSSLVRQAVQELLNIFSFPFFTENGNSGCFVGCGEPLNRWL 871 Query: 254 DQSYVERMHLL 222 QSYVERMHLL Sbjct: 872 LQSYVERMHLL 882 >ref|XP_018445813.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74750-like [Raphanus sativus] Length = 749 Score = 136 bits (343), Expect = 2e-34 Identities = 61/70 (87%), Positives = 66/70 (94%) Frame = -1 Query: 431 CPSRIDIVTGWGRRSRVTGTSLVRQSVQELLNIFQFPFFTENGNSGCFVGCGEPLCRWLD 252 CPSRIDIVTGWGRRSRVTGTS+VRQ+V+ELLN+F FPFFTENGNSGCFVGCGEPL WL Sbjct: 680 CPSRIDIVTGWGRRSRVTGTSMVRQAVEELLNVFNFPFFTENGNSGCFVGCGEPLKNWLH 739 Query: 251 QSYVERMHLL 222 +SYVERMHLL Sbjct: 740 ESYVERMHLL 749 >gb|PKI78031.1| hypothetical protein CRG98_001651 [Punica granatum] Length = 491 Score = 134 bits (338), Expect = 2e-34 Identities = 61/71 (85%), Positives = 67/71 (94%) Frame = -1 Query: 434 VCPSRIDIVTGWGRRSRVTGTSLVRQSVQELLNIFQFPFFTENGNSGCFVGCGEPLCRWL 255 V P+RIDIVTGWGRRSR+TG+SLVRQ+VQELLN+F FPFFTENGN+GCFVGCGEPL RWL Sbjct: 421 VSPTRIDIVTGWGRRSRITGSSLVRQAVQELLNLFSFPFFTENGNTGCFVGCGEPLNRWL 480 Query: 254 DQSYVERMHLL 222 QSYVERMHLL Sbjct: 481 HQSYVERMHLL 491 >gb|EFH63816.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 845 Score = 136 bits (343), Expect = 2e-34 Identities = 62/70 (88%), Positives = 67/70 (95%) Frame = -1 Query: 431 CPSRIDIVTGWGRRSRVTGTSLVRQSVQELLNIFQFPFFTENGNSGCFVGCGEPLCRWLD 252 CPSRIDIVTGWGRRSRVTGTS+VRQ+V+ELLNIF FPFFTENGNSGCFVGCGEPL +WL Sbjct: 776 CPSRIDIVTGWGRRSRVTGTSMVRQAVEELLNIFNFPFFTENGNSGCFVGCGEPLKKWLL 835 Query: 251 QSYVERMHLL 222 +SYVERMHLL Sbjct: 836 ESYVERMHLL 845 >ref|XP_020890662.1| pentatricopeptide repeat-containing protein At1g74750 [Arabidopsis lyrata subsp. lyrata] ref|XP_020890663.1| pentatricopeptide repeat-containing protein At1g74750 [Arabidopsis lyrata subsp. lyrata] Length = 850 Score = 136 bits (343), Expect = 2e-34 Identities = 62/70 (88%), Positives = 67/70 (95%) Frame = -1 Query: 431 CPSRIDIVTGWGRRSRVTGTSLVRQSVQELLNIFQFPFFTENGNSGCFVGCGEPLCRWLD 252 CPSRIDIVTGWGRRSRVTGTS+VRQ+V+ELLNIF FPFFTENGNSGCFVGCGEPL +WL Sbjct: 781 CPSRIDIVTGWGRRSRVTGTSMVRQAVEELLNIFNFPFFTENGNSGCFVGCGEPLKKWLL 840 Query: 251 QSYVERMHLL 222 +SYVERMHLL Sbjct: 841 ESYVERMHLL 850