BLASTX nr result
ID: Chrysanthemum22_contig00024768
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00024768 (484 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OTG33106.1| putative PPC domain-containing protein [Helianthu... 55 6e-06 ref|XP_022030189.1| AT-hook motif nuclear-localized protein 1-li... 55 6e-06 >gb|OTG33106.1| putative PPC domain-containing protein [Helianthus annuus] Length = 333 Score = 55.5 bits (132), Expect = 6e-06 Identities = 30/46 (65%), Positives = 33/46 (71%) Frame = -1 Query: 142 LSQSFTPGESGRVTSREVRMSIAPSSADGRVAGSPLRRILTATGPV 5 LS SFTPGE G ++SRE MSIA SS DGRV G L +LTA GPV Sbjct: 191 LSGSFTPGEVGGISSREGGMSIALSSPDGRVVGGLLAGLLTAAGPV 236 >ref|XP_022030189.1| AT-hook motif nuclear-localized protein 1-like [Helianthus annuus] ref|XP_022030190.1| AT-hook motif nuclear-localized protein 1-like [Helianthus annuus] ref|XP_022030191.1| AT-hook motif nuclear-localized protein 1-like [Helianthus annuus] ref|XP_022030192.1| AT-hook motif nuclear-localized protein 1-like [Helianthus annuus] Length = 340 Score = 55.5 bits (132), Expect = 6e-06 Identities = 30/46 (65%), Positives = 33/46 (71%) Frame = -1 Query: 142 LSQSFTPGESGRVTSREVRMSIAPSSADGRVAGSPLRRILTATGPV 5 LS SFTPGE G ++SRE MSIA SS DGRV G L +LTA GPV Sbjct: 198 LSGSFTPGEVGGISSREGGMSIALSSPDGRVVGGLLAGLLTAAGPV 243