BLASTX nr result
ID: Chrysanthemum22_contig00024683
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00024683 (951 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023770087.1| cytochrome b561 and DOMON domain-containing ... 58 8e-06 >ref|XP_023770087.1| cytochrome b561 and DOMON domain-containing protein At5g35735-like [Lactuca sativa] gb|PLY80646.1| hypothetical protein LSAT_5X123120 [Lactuca sativa] Length = 388 Score = 58.2 bits (139), Expect = 8e-06 Identities = 35/78 (44%), Positives = 39/78 (50%), Gaps = 30/78 (38%) Frame = -2 Query: 458 ICWGILMPMGAMIARYVKVFK------------------------------LRSDSAGIK 369 + WG++MPMGAM ARY+KVFK L SDS GIK Sbjct: 214 VSWGVMMPMGAMAARYLKVFKSANPAWFYIHVTCQASAYIVGVAGWATGLKLGSDSVGIK 273 Query: 368 *ATHRNTRIALFALGTFQ 315 THRN IALFALGT Q Sbjct: 274 YNTHRNIGIALFALGTLQ 291