BLASTX nr result
ID: Chrysanthemum22_contig00024456
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00024456 (439 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVH94730.1| Phospholipid/glycerol acyltransferase [Cynara car... 57 1e-06 gb|OTG00408.1| hypothetical protein HannXRQ_Chr13g0390621 [Helia... 55 2e-06 ref|XP_022000042.1| 1-acyl-sn-glycerol-3-phosphate acyltransfera... 55 8e-06 >gb|KVH94730.1| Phospholipid/glycerol acyltransferase [Cynara cardunculus var. scolymus] Length = 365 Score = 57.0 bits (136), Expect = 1e-06 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = +2 Query: 2 DDLLDNHKAADSFPDSEPHDIGRPLKSLVVI 94 DDLLD HKA DSFPDS HDIGRPLKSLVV+ Sbjct: 257 DDLLDKHKAEDSFPDSNLHDIGRPLKSLVVV 287 >gb|OTG00408.1| hypothetical protein HannXRQ_Chr13g0390621 [Helianthus annuus] Length = 146 Score = 54.7 bits (130), Expect = 2e-06 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = +2 Query: 2 DDLLDNHKAADSFPDSEPHDIGRPLKSLVVI 94 DDLLD HK ADSFPDSE DIGRPLKSLVV+ Sbjct: 41 DDLLDQHKIADSFPDSELVDIGRPLKSLVVV 71 >ref|XP_022000042.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like [Helianthus annuus] gb|ABP93351.1| lysophosphatidyl acyltransferase 2 [Helianthus annuus] gb|OTG00411.1| putative phospholipid/glycerol acyltransferase, Acyltransferase domain protein [Helianthus annuus] Length = 385 Score = 54.7 bits (130), Expect = 8e-06 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = +2 Query: 2 DDLLDNHKAADSFPDSEPHDIGRPLKSLVVI 94 DDLLD HK ADSFPDSE DIGRPLKSLVV+ Sbjct: 280 DDLLDQHKIADSFPDSELVDIGRPLKSLVVV 310