BLASTX nr result
ID: Chrysanthemum22_contig00024228
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00024228 (444 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023765421.1| putative pentatricopeptide repeat-containing... 85 2e-16 gb|PLY84264.1| hypothetical protein LSAT_8X80200 [Lactuca sativa] 85 2e-16 emb|CBI41047.3| unnamed protein product, partial [Vitis vinifera] 84 4e-16 emb|CAN71515.1| hypothetical protein VITISV_021787 [Vitis vinifera] 84 4e-16 ref|XP_003635394.2| PREDICTED: putative pentatricopeptide repeat... 84 4e-16 gb|OVA07273.1| Pentatricopeptide repeat [Macleaya cordata] 84 4e-16 gb|KVI02734.1| Pentatricopeptide repeat-containing protein [Cyna... 84 6e-16 ref|XP_022843813.1| pentatricopeptide repeat-containing protein ... 84 8e-16 gb|POE80261.1| pentatricopeptide repeat-containing protein [Quer... 81 1e-15 gb|KZV25349.1| pentatricopeptide repeat-containing protein [Dorc... 83 1e-15 gb|POO00318.1| Tetratricopeptide-like helical domain containing ... 83 1e-15 gb|PON48951.1| Tetratricopeptide-like helical domain containing ... 83 1e-15 ref|XP_018816443.1| PREDICTED: putative pentatricopeptide repeat... 83 1e-15 gb|POE84111.1| putative pentatricopeptide repeat-containing prot... 82 2e-15 gb|POE84110.1| putative pentatricopeptide repeat-containing prot... 82 2e-15 ref|XP_023873840.1| putative pentatricopeptide repeat-containing... 82 2e-15 ref|XP_009611810.1| PREDICTED: putative pentatricopeptide repeat... 82 3e-15 ref|XP_021969823.1| putative pentatricopeptide repeat-containing... 82 3e-15 ref|XP_021969822.1| putative pentatricopeptide repeat-containing... 82 3e-15 gb|PIN07827.1| hypothetical protein CDL12_19596 [Handroanthus im... 82 3e-15 >ref|XP_023765421.1| putative pentatricopeptide repeat-containing protein At5g65820 [Lactuca sativa] Length = 673 Score = 85.1 bits (209), Expect = 2e-16 Identities = 39/43 (90%), Positives = 42/43 (97%) Frame = -3 Query: 442 TIKNFTSLLYAWCKEGKLMEAKFVLVQIREAGFEPDIVVYNNL 314 TIK+FTSLLY WCKEGKLMEAKFVLVQ+REAGF+PDIVVYNNL Sbjct: 279 TIKHFTSLLYGWCKEGKLMEAKFVLVQMREAGFDPDIVVYNNL 321 >gb|PLY84264.1| hypothetical protein LSAT_8X80200 [Lactuca sativa] Length = 1152 Score = 85.1 bits (209), Expect = 2e-16 Identities = 39/43 (90%), Positives = 42/43 (97%) Frame = -3 Query: 442 TIKNFTSLLYAWCKEGKLMEAKFVLVQIREAGFEPDIVVYNNL 314 TIK+FTSLLY WCKEGKLMEAKFVLVQ+REAGF+PDIVVYNNL Sbjct: 273 TIKHFTSLLYGWCKEGKLMEAKFVLVQMREAGFDPDIVVYNNL 315 >emb|CBI41047.3| unnamed protein product, partial [Vitis vinifera] Length = 514 Score = 84.3 bits (207), Expect = 4e-16 Identities = 38/43 (88%), Positives = 42/43 (97%) Frame = -3 Query: 442 TIKNFTSLLYAWCKEGKLMEAKFVLVQIREAGFEPDIVVYNNL 314 T+K+FTSLLY WC+EGKLMEAK+VLVQIREAGFEPDIVVYNNL Sbjct: 118 TLKHFTSLLYGWCREGKLMEAKYVLVQIREAGFEPDIVVYNNL 160 >emb|CAN71515.1| hypothetical protein VITISV_021787 [Vitis vinifera] Length = 655 Score = 84.3 bits (207), Expect = 4e-16 Identities = 38/43 (88%), Positives = 42/43 (97%) Frame = -3 Query: 442 TIKNFTSLLYAWCKEGKLMEAKFVLVQIREAGFEPDIVVYNNL 314 T+K+FTSLLY WC+EGKLMEAK+VLVQIREAGFEPDIVVYNNL Sbjct: 259 TLKHFTSLLYGWCREGKLMEAKYVLVQIREAGFEPDIVVYNNL 301 >ref|XP_003635394.2| PREDICTED: putative pentatricopeptide repeat-containing protein At5g65820 [Vitis vinifera] ref|XP_010647154.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g65820 [Vitis vinifera] ref|XP_010647155.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g65820 [Vitis vinifera] Length = 675 Score = 84.3 bits (207), Expect = 4e-16 Identities = 38/43 (88%), Positives = 42/43 (97%) Frame = -3 Query: 442 TIKNFTSLLYAWCKEGKLMEAKFVLVQIREAGFEPDIVVYNNL 314 T+K+FTSLLY WC+EGKLMEAK+VLVQIREAGFEPDIVVYNNL Sbjct: 279 TLKHFTSLLYGWCREGKLMEAKYVLVQIREAGFEPDIVVYNNL 321 >gb|OVA07273.1| Pentatricopeptide repeat [Macleaya cordata] Length = 760 Score = 84.3 bits (207), Expect = 4e-16 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = -3 Query: 439 IKNFTSLLYAWCKEGKLMEAKFVLVQIREAGFEPDIVVYNNL 314 IK+FTSLLY WCKEGKLMEAKFVLVQ+REAGFEPDIVVYNNL Sbjct: 281 IKHFTSLLYGWCKEGKLMEAKFVLVQMREAGFEPDIVVYNNL 322 >gb|KVI02734.1| Pentatricopeptide repeat-containing protein [Cynara cardunculus var. scolymus] Length = 648 Score = 84.0 bits (206), Expect = 6e-16 Identities = 39/43 (90%), Positives = 41/43 (95%) Frame = -3 Query: 442 TIKNFTSLLYAWCKEGKLMEAKFVLVQIREAGFEPDIVVYNNL 314 TI +FTSLLY WCKEGKLMEAKFVLVQ+REAGFEPDIVVYNNL Sbjct: 254 TIMHFTSLLYGWCKEGKLMEAKFVLVQMREAGFEPDIVVYNNL 296 >ref|XP_022843813.1| pentatricopeptide repeat-containing protein At3g49730-like [Olea europaea var. sylvestris] Length = 674 Score = 83.6 bits (205), Expect = 8e-16 Identities = 38/43 (88%), Positives = 42/43 (97%) Frame = -3 Query: 442 TIKNFTSLLYAWCKEGKLMEAKFVLVQIREAGFEPDIVVYNNL 314 TIK+FTSLLY WC+EGKLMEAKFVLV++REAGFEPDIVVYNNL Sbjct: 278 TIKHFTSLLYGWCREGKLMEAKFVLVKMREAGFEPDIVVYNNL 320 >gb|POE80261.1| pentatricopeptide repeat-containing protein [Quercus suber] Length = 261 Score = 81.3 bits (199), Expect = 1e-15 Identities = 36/43 (83%), Positives = 42/43 (97%) Frame = -3 Query: 442 TIKNFTSLLYAWCKEGKLMEAKFVLVQIREAGFEPDIVVYNNL 314 T+++FTSLLY WCKEG+L+EAKFVLVQ+REAGFEPDIVVYNNL Sbjct: 166 TLRHFTSLLYGWCKEGQLIEAKFVLVQMREAGFEPDIVVYNNL 208 >gb|KZV25349.1| pentatricopeptide repeat-containing protein [Dorcoceras hygrometricum] Length = 627 Score = 83.2 bits (204), Expect = 1e-15 Identities = 37/43 (86%), Positives = 42/43 (97%) Frame = -3 Query: 442 TIKNFTSLLYAWCKEGKLMEAKFVLVQIREAGFEPDIVVYNNL 314 TIK+FTSLLY WCKEGKLMEAKFVL+++REAGFEPD+VVYNNL Sbjct: 231 TIKHFTSLLYGWCKEGKLMEAKFVLMKMREAGFEPDVVVYNNL 273 >gb|POO00318.1| Tetratricopeptide-like helical domain containing protein [Trema orientalis] Length = 659 Score = 83.2 bits (204), Expect = 1e-15 Identities = 38/57 (66%), Positives = 47/57 (82%) Frame = -3 Query: 442 TIKNFTSLLYAWCKEGKLMEAKFVLVQIREAGFEPDIVVYNNL*YRVTHQKNYQNIF 272 ++K+FTSLLY WC+EGKLMEAKFVLVQ+REAGFEPDIVVYNNL +H + + + Sbjct: 262 SLKHFTSLLYGWCREGKLMEAKFVLVQMREAGFEPDIVVYNNLLGGYSHARKMADAY 318 >gb|PON48951.1| Tetratricopeptide-like helical domain containing protein [Parasponia andersonii] Length = 659 Score = 83.2 bits (204), Expect = 1e-15 Identities = 38/57 (66%), Positives = 47/57 (82%) Frame = -3 Query: 442 TIKNFTSLLYAWCKEGKLMEAKFVLVQIREAGFEPDIVVYNNL*YRVTHQKNYQNIF 272 ++K+FTSLLY WC+EGKLMEAKFVLVQ+REAGFEPDIVVYNNL +H + + + Sbjct: 262 SLKHFTSLLYGWCREGKLMEAKFVLVQMREAGFEPDIVVYNNLLGGYSHARKMADAY 318 >ref|XP_018816443.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g65820 [Juglans regia] Length = 674 Score = 83.2 bits (204), Expect = 1e-15 Identities = 37/43 (86%), Positives = 42/43 (97%) Frame = -3 Query: 442 TIKNFTSLLYAWCKEGKLMEAKFVLVQIREAGFEPDIVVYNNL 314 T+K+FTSLLY WC+EGKLMEAKFVLVQ+REAGFEPD+VVYNNL Sbjct: 278 TLKHFTSLLYGWCREGKLMEAKFVLVQMREAGFEPDMVVYNNL 320 >gb|POE84111.1| putative pentatricopeptide repeat-containing protein [Quercus suber] Length = 561 Score = 82.4 bits (202), Expect = 2e-15 Identities = 37/43 (86%), Positives = 42/43 (97%) Frame = -3 Query: 442 TIKNFTSLLYAWCKEGKLMEAKFVLVQIREAGFEPDIVVYNNL 314 T+K+FTSLLY WCKEG+L+EAKFVLVQ+REAGFEPDIVVYNNL Sbjct: 141 TLKHFTSLLYGWCKEGQLIEAKFVLVQMREAGFEPDIVVYNNL 183 >gb|POE84110.1| putative pentatricopeptide repeat-containing protein [Quercus suber] Length = 577 Score = 82.4 bits (202), Expect = 2e-15 Identities = 37/43 (86%), Positives = 42/43 (97%) Frame = -3 Query: 442 TIKNFTSLLYAWCKEGKLMEAKFVLVQIREAGFEPDIVVYNNL 314 T+K+FTSLLY WCKEG+L+EAKFVLVQ+REAGFEPDIVVYNNL Sbjct: 141 TLKHFTSLLYGWCKEGQLIEAKFVLVQMREAGFEPDIVVYNNL 183 >ref|XP_023873840.1| putative pentatricopeptide repeat-containing protein At5g65820 [Quercus suber] ref|XP_023873841.1| putative pentatricopeptide repeat-containing protein At5g65820 [Quercus suber] ref|XP_023873842.1| putative pentatricopeptide repeat-containing protein At5g65820 [Quercus suber] ref|XP_023873843.1| putative pentatricopeptide repeat-containing protein At5g65820 [Quercus suber] ref|XP_023873844.1| putative pentatricopeptide repeat-containing protein At5g65820 [Quercus suber] Length = 661 Score = 82.4 bits (202), Expect = 2e-15 Identities = 37/43 (86%), Positives = 42/43 (97%) Frame = -3 Query: 442 TIKNFTSLLYAWCKEGKLMEAKFVLVQIREAGFEPDIVVYNNL 314 T+K+FTSLLY WCKEG+L+EAKFVLVQ+REAGFEPDIVVYNNL Sbjct: 266 TLKHFTSLLYGWCKEGQLIEAKFVLVQMREAGFEPDIVVYNNL 308 >ref|XP_009611810.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g65820 [Nicotiana tomentosiformis] ref|XP_009611811.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g65820 [Nicotiana tomentosiformis] ref|XP_009611812.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g65820 [Nicotiana tomentosiformis] ref|XP_009611815.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g65820 [Nicotiana tomentosiformis] ref|XP_016471358.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g65820 [Nicotiana tabacum] Length = 618 Score = 82.0 bits (201), Expect = 3e-15 Identities = 38/43 (88%), Positives = 41/43 (95%) Frame = -3 Query: 442 TIKNFTSLLYAWCKEGKLMEAKFVLVQIREAGFEPDIVVYNNL 314 TIK+FTSLLY WCKEGKLMEAK VLV++REAGFEPDIVVYNNL Sbjct: 222 TIKHFTSLLYGWCKEGKLMEAKVVLVKMREAGFEPDIVVYNNL 264 >ref|XP_021969823.1| putative pentatricopeptide repeat-containing protein At5g65820 isoform X2 [Helianthus annuus] gb|OTG22509.1| putative pentatricopeptide repeat (PPR) superfamily protein [Helianthus annuus] Length = 657 Score = 82.0 bits (201), Expect = 3e-15 Identities = 37/43 (86%), Positives = 41/43 (95%) Frame = -3 Query: 442 TIKNFTSLLYAWCKEGKLMEAKFVLVQIREAGFEPDIVVYNNL 314 TIK+FTSLLY WCKEGKLMEAKFVLVQ++ AGF+PDIVVYNNL Sbjct: 263 TIKHFTSLLYGWCKEGKLMEAKFVLVQMKNAGFDPDIVVYNNL 305 >ref|XP_021969822.1| putative pentatricopeptide repeat-containing protein At5g65820 isoform X1 [Helianthus annuus] Length = 658 Score = 82.0 bits (201), Expect = 3e-15 Identities = 37/43 (86%), Positives = 41/43 (95%) Frame = -3 Query: 442 TIKNFTSLLYAWCKEGKLMEAKFVLVQIREAGFEPDIVVYNNL 314 TIK+FTSLLY WCKEGKLMEAKFVLVQ++ AGF+PDIVVYNNL Sbjct: 264 TIKHFTSLLYGWCKEGKLMEAKFVLVQMKNAGFDPDIVVYNNL 306 >gb|PIN07827.1| hypothetical protein CDL12_19596 [Handroanthus impetiginosus] Length = 667 Score = 82.0 bits (201), Expect = 3e-15 Identities = 38/43 (88%), Positives = 41/43 (95%) Frame = -3 Query: 442 TIKNFTSLLYAWCKEGKLMEAKFVLVQIREAGFEPDIVVYNNL 314 TIK+FTSLLY WCKEGKLMEAK VLV++REAGFEPDIVVYNNL Sbjct: 271 TIKHFTSLLYGWCKEGKLMEAKVVLVKMREAGFEPDIVVYNNL 313