BLASTX nr result
ID: Chrysanthemum22_contig00023907
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00023907 (366 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_024016074.1| cyclin-dependent kinase C-2 isoform X4 [Eutr... 69 5e-11 ref|XP_023729352.1| cyclin-dependent kinase C-2-like [Lactuca sa... 55 4e-07 gb|PLY77336.1| hypothetical protein LSAT_5X65380 [Lactuca sativa] 55 2e-06 gb|ACS68789.1| cdc2 kinase, partial [Prunus incisa] 53 3e-06 ref|XP_023729351.1| cyclin-dependent kinase C-1-like, partial [L... 55 4e-06 ref|XP_022010894.1| cyclin-dependent kinase C-2-like [Helianthus... 55 4e-06 gb|KJB25072.1| hypothetical protein B456_004G175700 [Gossypium r... 54 5e-06 gb|KVH57454.1| Protein kinase, catalytic domain-containing prote... 54 5e-06 gb|POO03376.1| hypothetical protein TorRG33x02_005810 [Trema ori... 53 7e-06 gb|PON74957.1| hypothetical protein PanWU01x14_046740 [Parasponi... 53 7e-06 ref|XP_020594336.1| cyclin-dependent kinase C-2-like, partial [P... 53 8e-06 ref|XP_022870820.1| cyclin-dependent kinase C-1-like [Olea europ... 53 1e-05 gb|ONM08763.1| hypothetical protein ZEAMMB73_Zm00001d033847 [Zea... 53 1e-05 >ref|XP_024016074.1| cyclin-dependent kinase C-2 isoform X4 [Eutrema salsugineum] Length = 418 Score = 68.6 bits (166), Expect = 5e-11 Identities = 46/121 (38%), Positives = 53/121 (43%) Frame = -2 Query: 365 LREVFRHFDRHALELLEKMLTLDPEKVLFSWTCMPLIFSLIQMSITCIYRTTINMP*RLH 186 +RE F FDRHALELLEKML LDP +V +P + L +S Sbjct: 172 VRETFWSFDRHALELLEKMLVLDPSEVPKLSEILPKLQKLKSLSS--------------- 216 Query: 185 IYHSYCVTNFMNYVYTENVVLGFTYAYYFRSFVFSVM*RISAKDALDAEYFWIDPLPCDP 6 F ++ RISAKDALDAEYFW DPLPCDP Sbjct: 217 ---------------------------------FLLVQRISAKDALDAEYFWTDPLPCDP 243 Query: 5 K 3 K Sbjct: 244 K 244 >ref|XP_023729352.1| cyclin-dependent kinase C-2-like [Lactuca sativa] Length = 104 Score = 54.7 bits (130), Expect = 4e-07 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -2 Query: 71 RISAKDALDAEYFWIDPLPCDPK 3 RISAKDALDAEYFWIDPLPCDPK Sbjct: 9 RISAKDALDAEYFWIDPLPCDPK 31 >gb|PLY77336.1| hypothetical protein LSAT_5X65380 [Lactuca sativa] Length = 189 Score = 54.7 bits (130), Expect = 2e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -2 Query: 71 RISAKDALDAEYFWIDPLPCDPK 3 RISAKDALDAEYFWIDPLPCDPK Sbjct: 126 RISAKDALDAEYFWIDPLPCDPK 148 >gb|ACS68789.1| cdc2 kinase, partial [Prunus incisa] Length = 124 Score = 52.8 bits (125), Expect = 3e-06 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = -2 Query: 71 RISAKDALDAEYFWIDPLPCDPK 3 RISAKDALDAEYFW DPLPCDPK Sbjct: 90 RISAKDALDAEYFWADPLPCDPK 112 Score = 51.6 bits (122), Expect = 8e-06 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = -2 Query: 365 LREVFRHFDRHALELLEKMLTLDPEK 288 LREVFRHFDRHALELLE+MLTLDP + Sbjct: 64 LREVFRHFDRHALELLERMLTLDPSQ 89 >ref|XP_023729351.1| cyclin-dependent kinase C-1-like, partial [Lactuca sativa] Length = 403 Score = 54.7 bits (130), Expect = 4e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -2 Query: 71 RISAKDALDAEYFWIDPLPCDPK 3 RISAKDALDAEYFWIDPLPCDPK Sbjct: 323 RISAKDALDAEYFWIDPLPCDPK 345 >ref|XP_022010894.1| cyclin-dependent kinase C-2-like [Helianthus annuus] gb|OTF94172.1| putative serine/threonine-protein kinase Rad53 [Helianthus annuus] Length = 498 Score = 54.7 bits (130), Expect = 4e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -2 Query: 71 RISAKDALDAEYFWIDPLPCDPK 3 RISAKDALDAEYFWIDPLPCDPK Sbjct: 312 RISAKDALDAEYFWIDPLPCDPK 334 >gb|KJB25072.1| hypothetical protein B456_004G175700 [Gossypium raimondii] Length = 349 Score = 54.3 bits (129), Expect = 5e-06 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -2 Query: 365 LREVFRHFDRHALELLEKMLTLDPEKVLF 279 LREVFRHFDRHALELLE+MLTLDP +V F Sbjct: 286 LREVFRHFDRHALELLERMLTLDPSQVPF 314 >gb|KVH57454.1| Protein kinase, catalytic domain-containing protein [Cynara cardunculus var. scolymus] Length = 477 Score = 54.3 bits (129), Expect = 5e-06 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = -2 Query: 365 LREVFRHFDRHALELLEKMLTLDPEKV 285 LREVFRHFDRHALELLEKMLTLDP +V Sbjct: 248 LREVFRHFDRHALELLEKMLTLDPSQV 274 >gb|POO03376.1| hypothetical protein TorRG33x02_005810 [Trema orientalis] Length = 207 Score = 53.1 bits (126), Expect = 7e-06 Identities = 23/25 (92%), Positives = 23/25 (92%) Frame = -2 Query: 77 M*RISAKDALDAEYFWIDPLPCDPK 3 M RISAKDALDAEYFW DPLPCDPK Sbjct: 1 MKRISAKDALDAEYFWTDPLPCDPK 25 >gb|PON74957.1| hypothetical protein PanWU01x14_046740 [Parasponia andersonii] Length = 208 Score = 53.1 bits (126), Expect = 7e-06 Identities = 23/25 (92%), Positives = 23/25 (92%) Frame = -2 Query: 77 M*RISAKDALDAEYFWIDPLPCDPK 3 M RISAKDALDAEYFW DPLPCDPK Sbjct: 1 MKRISAKDALDAEYFWTDPLPCDPK 25 >ref|XP_020594336.1| cyclin-dependent kinase C-2-like, partial [Phalaenopsis equestris] Length = 191 Score = 52.8 bits (125), Expect = 8e-06 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = -2 Query: 71 RISAKDALDAEYFWIDPLPCDPK 3 RISAKDALDAEYFW DPLPCDPK Sbjct: 22 RISAKDALDAEYFWADPLPCDPK 44 >ref|XP_022870820.1| cyclin-dependent kinase C-1-like [Olea europaea var. sylvestris] Length = 204 Score = 52.8 bits (125), Expect = 1e-05 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = -2 Query: 71 RISAKDALDAEYFWIDPLPCDPK 3 RISAKDALDAEYFW DPLPCDPK Sbjct: 9 RISAKDALDAEYFWADPLPCDPK 31 >gb|ONM08763.1| hypothetical protein ZEAMMB73_Zm00001d033847 [Zea mays] Length = 206 Score = 52.8 bits (125), Expect = 1e-05 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = -2 Query: 71 RISAKDALDAEYFWIDPLPCDPK 3 RISAKDALDAEYFW DPLPCDPK Sbjct: 9 RISAKDALDAEYFWTDPLPCDPK 31