BLASTX nr result
ID: Chrysanthemum22_contig00023904
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00023904 (371 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVH97883.1| hypothetical protein Ccrd_000001 [Cynara carduncu... 60 7e-08 >gb|KVH97883.1| hypothetical protein Ccrd_000001 [Cynara cardunculus var. scolymus] Length = 425 Score = 59.7 bits (143), Expect = 7e-08 Identities = 27/39 (69%), Positives = 31/39 (79%) Frame = +3 Query: 3 ASAISQKTQNLWKYVTNRNFTNGEKYRNINHMLSRDIVI 119 ASAISQK+QN+WKYVT NFTN E+YRN N ML D +I Sbjct: 280 ASAISQKSQNMWKYVTGSNFTNQERYRNGNQMLPEDTII 318